Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9U7Q4

Protein Details
Accession A0A0C9U7Q4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
31-64REYPPSHHLRPRPRPRPRPRPRPRLRPRLGRIPPBasic
NLS Segment(s)
PositionSequence
39-64LRPRPRPRPRPRPRPRLRPRLGRIPP
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSLKYVTLEPSRFRWYPSSVTGGQHRSDWSREYPPSHHLRPRPRPRPRPRPRPRLRPRLGRIPPARVGVIMRYGDLGDTVVAEGGLDEEHVGGAVGRGGGEFVFGLHGEDGAGGVLEGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.39
4 0.39
5 0.4
6 0.35
7 0.38
8 0.42
9 0.4
10 0.37
11 0.34
12 0.33
13 0.3
14 0.3
15 0.29
16 0.27
17 0.3
18 0.33
19 0.35
20 0.35
21 0.39
22 0.44
23 0.47
24 0.49
25 0.5
26 0.58
27 0.65
28 0.73
29 0.77
30 0.8
31 0.85
32 0.89
33 0.93
34 0.93
35 0.93
36 0.92
37 0.93
38 0.92
39 0.92
40 0.92
41 0.92
42 0.88
43 0.87
44 0.82
45 0.81
46 0.75
47 0.73
48 0.66
49 0.6
50 0.55
51 0.46
52 0.41
53 0.31
54 0.27
55 0.19
56 0.2
57 0.15
58 0.12
59 0.1
60 0.1
61 0.09
62 0.09
63 0.08
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.04
89 0.04
90 0.05
91 0.05
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.03