Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UAM8

Protein Details
Accession A0A0C9UAM8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-33PCELCDERERKKKNEKKVEIRAQKAKEBasic
NLS Segment(s)
PositionSequence
15-32ERKKKNEKKVEIRAQKAK
Subcellular Location(s) nucl 15, cyto_nucl 12.333, mito_nucl 9.833, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MVIESTPCELCDERERKKKNEKKVEIRAQKAKEQETKMMSWQKFTKKAEKKGVNIAGVSGTSIFKTPDNPYGKVGVTGSGRGMTEVSQRGKHVFSPTDTDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.62
4 0.73
5 0.76
6 0.77
7 0.81
8 0.82
9 0.82
10 0.87
11 0.9
12 0.87
13 0.88
14 0.85
15 0.77
16 0.72
17 0.67
18 0.62
19 0.59
20 0.53
21 0.5
22 0.44
23 0.42
24 0.43
25 0.46
26 0.39
27 0.36
28 0.39
29 0.4
30 0.44
31 0.46
32 0.5
33 0.51
34 0.59
35 0.65
36 0.65
37 0.61
38 0.61
39 0.62
40 0.53
41 0.44
42 0.36
43 0.26
44 0.2
45 0.18
46 0.1
47 0.06
48 0.05
49 0.06
50 0.07
51 0.07
52 0.1
53 0.13
54 0.2
55 0.25
56 0.26
57 0.27
58 0.29
59 0.29
60 0.28
61 0.25
62 0.21
63 0.17
64 0.17
65 0.16
66 0.14
67 0.14
68 0.13
69 0.13
70 0.1
71 0.15
72 0.2
73 0.23
74 0.24
75 0.26
76 0.29
77 0.3
78 0.33
79 0.34
80 0.32
81 0.31