Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W1F2

Protein Details
Accession A0A0C9W1F2   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-53SVLNRRIILRRCQTRRRPKAPRSPRCRLPRSNPTAAHydrophilic
113-136KSMLRLLHRPRHQRRSHQHQAQTTHydrophilic
NLS Segment(s)
PositionSequence
32-42RRRPKAPRSPR
110-113RRIK
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MCPRCIHAIHTASQRCTSVLNRRIILRRCQTRRRPKAPRSPRCRLPRSNPTAAGSRPASNPPTIRPSSTKPSSSYTGPALFDIRPISGMSVSFVVRHCCSSRRIRLSGHRRIKSMLRLLHRPRHQRRSHQHQAQTTGVSEVAQVAQAATTTQRTITITTKPTPCTYLHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.36
3 0.36
4 0.37
5 0.38
6 0.4
7 0.44
8 0.43
9 0.49
10 0.57
11 0.59
12 0.62
13 0.61
14 0.64
15 0.67
16 0.75
17 0.8
18 0.82
19 0.88
20 0.89
21 0.9
22 0.9
23 0.92
24 0.93
25 0.93
26 0.9
27 0.89
28 0.88
29 0.87
30 0.86
31 0.83
32 0.81
33 0.81
34 0.8
35 0.78
36 0.71
37 0.63
38 0.59
39 0.51
40 0.46
41 0.37
42 0.31
43 0.27
44 0.27
45 0.26
46 0.25
47 0.25
48 0.23
49 0.28
50 0.27
51 0.28
52 0.28
53 0.32
54 0.37
55 0.4
56 0.39
57 0.35
58 0.38
59 0.38
60 0.35
61 0.32
62 0.26
63 0.24
64 0.22
65 0.2
66 0.18
67 0.15
68 0.15
69 0.13
70 0.1
71 0.09
72 0.08
73 0.08
74 0.07
75 0.07
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08
81 0.11
82 0.11
83 0.13
84 0.14
85 0.15
86 0.2
87 0.28
88 0.36
89 0.4
90 0.42
91 0.45
92 0.54
93 0.61
94 0.67
95 0.68
96 0.63
97 0.58
98 0.58
99 0.58
100 0.54
101 0.52
102 0.48
103 0.43
104 0.49
105 0.55
106 0.61
107 0.64
108 0.68
109 0.71
110 0.75
111 0.77
112 0.79
113 0.82
114 0.83
115 0.86
116 0.84
117 0.82
118 0.76
119 0.75
120 0.67
121 0.58
122 0.48
123 0.38
124 0.3
125 0.22
126 0.17
127 0.12
128 0.09
129 0.08
130 0.07
131 0.06
132 0.06
133 0.06
134 0.06
135 0.07
136 0.09
137 0.09
138 0.09
139 0.11
140 0.13
141 0.16
142 0.19
143 0.25
144 0.28
145 0.34
146 0.39
147 0.41
148 0.42
149 0.42