Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VT45

Protein Details
Accession A0A0C9VT45    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-48RKCVFFRPLRTLRRRCDRRRLLPYINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 12.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MSIATAPKHPNMIKIKAKYQKGRKCVFFRPLRTLRRRCDRRRLLPYINGPPDTPSHPTTLTSCPFINAISAVPSGSKSNSARYIRVVMGLLRHPPHPFFGPPPHNPRYIHPRDTPHHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.63
4 0.71
5 0.73
6 0.76
7 0.76
8 0.76
9 0.79
10 0.78
11 0.77
12 0.76
13 0.76
14 0.74
15 0.71
16 0.72
17 0.73
18 0.74
19 0.77
20 0.77
21 0.76
22 0.79
23 0.83
24 0.81
25 0.83
26 0.84
27 0.84
28 0.85
29 0.84
30 0.78
31 0.74
32 0.73
33 0.7
34 0.63
35 0.54
36 0.45
37 0.38
38 0.35
39 0.3
40 0.27
41 0.19
42 0.18
43 0.17
44 0.18
45 0.2
46 0.22
47 0.2
48 0.19
49 0.18
50 0.16
51 0.16
52 0.15
53 0.12
54 0.09
55 0.08
56 0.07
57 0.07
58 0.06
59 0.06
60 0.07
61 0.08
62 0.08
63 0.13
64 0.13
65 0.17
66 0.26
67 0.28
68 0.28
69 0.3
70 0.33
71 0.28
72 0.29
73 0.25
74 0.17
75 0.18
76 0.2
77 0.22
78 0.2
79 0.22
80 0.22
81 0.22
82 0.25
83 0.26
84 0.26
85 0.27
86 0.36
87 0.42
88 0.48
89 0.55
90 0.55
91 0.57
92 0.56
93 0.58
94 0.59
95 0.59
96 0.58
97 0.57
98 0.62