Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9TRS7

Protein Details
Accession A0A0C9TRS7    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
66-86SDPERQSKRLRTRKNVDSIPKHydrophilic
NLS Segment(s)
PositionSequence
47-62KKVPAKRDRKPAANKQ
73-74KR
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MPITHLPLYRKLLDFISSKIPPQVSNTPNAPLSKYQQVNIQVAEPTKKVPAKRDRKPAANKQSPVSDPERQSKRLRTRKNVDSIPKTSGEPVDNGLGMNISAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.31
4 0.28
5 0.27
6 0.29
7 0.28
8 0.25
9 0.29
10 0.36
11 0.3
12 0.33
13 0.34
14 0.33
15 0.35
16 0.35
17 0.31
18 0.25
19 0.27
20 0.31
21 0.3
22 0.28
23 0.3
24 0.33
25 0.33
26 0.3
27 0.27
28 0.2
29 0.2
30 0.21
31 0.16
32 0.13
33 0.16
34 0.18
35 0.19
36 0.26
37 0.36
38 0.44
39 0.51
40 0.61
41 0.62
42 0.69
43 0.76
44 0.77
45 0.78
46 0.76
47 0.71
48 0.62
49 0.61
50 0.53
51 0.49
52 0.44
53 0.39
54 0.35
55 0.42
56 0.45
57 0.45
58 0.49
59 0.55
60 0.6
61 0.64
62 0.7
63 0.71
64 0.75
65 0.79
66 0.83
67 0.81
68 0.8
69 0.77
70 0.71
71 0.64
72 0.57
73 0.5
74 0.43
75 0.39
76 0.31
77 0.24
78 0.23
79 0.22
80 0.2
81 0.19
82 0.16
83 0.13
84 0.11