Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VDL8

Protein Details
Accession A0A0C9VDL8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-97FPATSKKRERAKPEYQLLKRFRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, E.R. 8, mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLIIHLIFLVRGTINNKPASGETGRTVILLLLPYLIGLFGIANLRMSTSSILSNIGFFINFITVIMDSDISNDYFPATSKKRERAKPEYQLLKRFRHPTTYTFYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.24
4 0.24
5 0.25
6 0.25
7 0.28
8 0.27
9 0.24
10 0.2
11 0.21
12 0.2
13 0.19
14 0.18
15 0.13
16 0.11
17 0.09
18 0.07
19 0.05
20 0.05
21 0.05
22 0.05
23 0.04
24 0.03
25 0.03
26 0.02
27 0.03
28 0.04
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.08
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.14
65 0.16
66 0.24
67 0.32
68 0.41
69 0.5
70 0.58
71 0.66
72 0.69
73 0.75
74 0.77
75 0.8
76 0.81
77 0.79
78 0.8
79 0.78
80 0.76
81 0.74
82 0.71
83 0.64
84 0.63
85 0.6
86 0.56