Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TLE5

Protein Details
Accession A0A0C9TLE5   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
7-38HSHLLPRTRQARHKTQKKIKKRRESSVGETIDHydrophilic
NLS Segment(s)
PositionSequence
15-29RQARHKTQKKIKKRR
60-125KKRAPAVSHGRKVQKEKADGTIPKPKAQTEKAEGNGSKPKRKSRSRGPGEEAPEITRSGTKTGKKA
Subcellular Location(s) mito 16.5, mito_nucl 13.333, nucl 9, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MCPVTNHSHLLPRTRQARHKTQKKIKKRRESSVGETIDLDGVGSAAESEPEPEPEPEPTKKRAPAVSHGRKVQKEKADGTIPKPKAQTEKAEGNGSKPKRKSRSRGPGEEAPEITRSGTKTGKKAPTRPGSQQSQRGTNPSDVDSDEDIVDELQVLFKGQATQLFVGQHEQVRELAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.63
4 0.72
5 0.75
6 0.8
7 0.83
8 0.85
9 0.88
10 0.9
11 0.93
12 0.93
13 0.93
14 0.92
15 0.91
16 0.9
17 0.87
18 0.83
19 0.82
20 0.73
21 0.62
22 0.54
23 0.44
24 0.34
25 0.26
26 0.18
27 0.08
28 0.06
29 0.04
30 0.04
31 0.03
32 0.03
33 0.04
34 0.04
35 0.06
36 0.06
37 0.09
38 0.11
39 0.11
40 0.13
41 0.16
42 0.21
43 0.25
44 0.28
45 0.31
46 0.36
47 0.38
48 0.41
49 0.43
50 0.42
51 0.45
52 0.53
53 0.57
54 0.57
55 0.6
56 0.62
57 0.6
58 0.62
59 0.59
60 0.54
61 0.49
62 0.46
63 0.44
64 0.44
65 0.42
66 0.42
67 0.44
68 0.39
69 0.38
70 0.37
71 0.34
72 0.33
73 0.34
74 0.34
75 0.3
76 0.33
77 0.32
78 0.36
79 0.34
80 0.32
81 0.37
82 0.35
83 0.37
84 0.37
85 0.43
86 0.48
87 0.56
88 0.61
89 0.65
90 0.73
91 0.74
92 0.77
93 0.75
94 0.71
95 0.68
96 0.62
97 0.52
98 0.42
99 0.35
100 0.28
101 0.22
102 0.18
103 0.14
104 0.15
105 0.2
106 0.22
107 0.26
108 0.34
109 0.43
110 0.47
111 0.53
112 0.6
113 0.63
114 0.65
115 0.68
116 0.67
117 0.67
118 0.68
119 0.69
120 0.64
121 0.63
122 0.59
123 0.55
124 0.51
125 0.46
126 0.41
127 0.34
128 0.31
129 0.24
130 0.26
131 0.23
132 0.21
133 0.17
134 0.15
135 0.14
136 0.12
137 0.11
138 0.07
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.07
145 0.09
146 0.1
147 0.13
148 0.15
149 0.16
150 0.18
151 0.2
152 0.2
153 0.21
154 0.23
155 0.23
156 0.21
157 0.21