Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VUG3

Protein Details
Accession A0A0C9VUG3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-55NDTWSENRSKRRRKSWTPRSRCRMDDHydrophilic
NLS Segment(s)
PositionSequence
39-43KRRRK
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MILGSLSTNETQRTQRLRMFSILLRYPPFNDTWSENRSKRRRKSWTPRSRCRMDDLCIGSIYGVQLLSMESKKLKTRLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.4
4 0.41
5 0.4
6 0.4
7 0.36
8 0.36
9 0.34
10 0.32
11 0.3
12 0.28
13 0.27
14 0.25
15 0.23
16 0.18
17 0.18
18 0.19
19 0.22
20 0.25
21 0.31
22 0.33
23 0.41
24 0.5
25 0.58
26 0.61
27 0.66
28 0.71
29 0.76
30 0.83
31 0.85
32 0.87
33 0.87
34 0.9
35 0.88
36 0.85
37 0.76
38 0.72
39 0.65
40 0.58
41 0.55
42 0.48
43 0.41
44 0.36
45 0.34
46 0.26
47 0.22
48 0.18
49 0.11
50 0.07
51 0.05
52 0.05
53 0.06
54 0.09
55 0.1
56 0.12
57 0.14
58 0.18
59 0.25