Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9U6C0

Protein Details
Accession A0A0C9U6C0   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-94HAPHPSSKPAPRHRRRNGRPHAAVKRLHRWRRRARRPYSKRAVYPEDABasic
NLS Segment(s)
PositionSequence
44-87HRRHAPHPSSKPAPRHRRRNGRPHAAVKRLHRWRRRARRPYSKR
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
Amino Acid Sequences VVRDMYERDNLHSRRRHDREPTSHNTVQHRARHAPQHCALQRTHRRHAPHPSSKPAPRHRRRNGRPHAAVKRLHRWRRRARRPYSKRAVYPEDARGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.66
4 0.67
5 0.74
6 0.74
7 0.76
8 0.77
9 0.75
10 0.72
11 0.68
12 0.63
13 0.6
14 0.58
15 0.55
16 0.53
17 0.48
18 0.49
19 0.54
20 0.51
21 0.51
22 0.47
23 0.51
24 0.48
25 0.46
26 0.43
27 0.44
28 0.51
29 0.51
30 0.54
31 0.49
32 0.51
33 0.54
34 0.64
35 0.63
36 0.63
37 0.61
38 0.61
39 0.63
40 0.64
41 0.68
42 0.67
43 0.69
44 0.69
45 0.75
46 0.78
47 0.83
48 0.87
49 0.89
50 0.88
51 0.88
52 0.86
53 0.85
54 0.83
55 0.78
56 0.75
57 0.71
58 0.71
59 0.72
60 0.73
61 0.72
62 0.74
63 0.78
64 0.84
65 0.88
66 0.88
67 0.89
68 0.91
69 0.93
70 0.93
71 0.93
72 0.9
73 0.86
74 0.84
75 0.8
76 0.76
77 0.72
78 0.68