Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UTL1

Protein Details
Accession A0A0C9UTL1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24IPQGHRTRRLCRLRPRAMVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MISLIPQGHRTRRLCRLRPRAMVLGPPASSQYLPQGLPPSQYPPQGSPPSQYPPQAPPSQQQYLPQGPPSLPITSTKPTAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.78
4 0.79
5 0.81
6 0.79
7 0.74
8 0.65
9 0.6
10 0.52
11 0.45
12 0.36
13 0.3
14 0.25
15 0.2
16 0.19
17 0.15
18 0.14
19 0.13
20 0.12
21 0.13
22 0.16
23 0.15
24 0.16
25 0.17
26 0.19
27 0.18
28 0.21
29 0.21
30 0.2
31 0.26
32 0.29
33 0.29
34 0.26
35 0.28
36 0.31
37 0.32
38 0.32
39 0.28
40 0.28
41 0.34
42 0.35
43 0.33
44 0.33
45 0.38
46 0.41
47 0.39
48 0.39
49 0.4
50 0.42
51 0.43
52 0.39
53 0.34
54 0.3
55 0.33
56 0.32
57 0.26
58 0.21
59 0.22
60 0.26
61 0.28