Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UP06

Protein Details
Accession A0A0C9UP06   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-31DASNGWKKVSKERRVKKARTVILAHydrophilic
NLS Segment(s)
PositionSequence
15-24KVSKERRVKK
Subcellular Location(s) mito 15.5, cyto_mito 11.833, cyto 7, cyto_nucl 5.333, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MGSYSARDASNGWKKVSKERRVKKARTVILAQQAILTGHSAIWENFEPKSNLTAKVKEETVAVTPVAKKVLGLNIRGSTPKRAVSVKVRKGRKQVIITEESEGGDEVYNKPLTIEEAEEADHNVSLGVLYITDAETQVVNNHKFIAKMVNAKKTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.52
3 0.61
4 0.61
5 0.62
6 0.69
7 0.77
8 0.82
9 0.86
10 0.86
11 0.85
12 0.81
13 0.77
14 0.71
15 0.67
16 0.66
17 0.6
18 0.49
19 0.39
20 0.33
21 0.27
22 0.22
23 0.16
24 0.07
25 0.06
26 0.07
27 0.08
28 0.07
29 0.1
30 0.11
31 0.12
32 0.12
33 0.15
34 0.16
35 0.15
36 0.2
37 0.19
38 0.22
39 0.25
40 0.28
41 0.27
42 0.29
43 0.29
44 0.24
45 0.23
46 0.19
47 0.17
48 0.15
49 0.12
50 0.11
51 0.11
52 0.11
53 0.11
54 0.1
55 0.08
56 0.08
57 0.14
58 0.15
59 0.16
60 0.17
61 0.17
62 0.18
63 0.2
64 0.2
65 0.18
66 0.18
67 0.18
68 0.18
69 0.18
70 0.21
71 0.3
72 0.39
73 0.45
74 0.51
75 0.56
76 0.58
77 0.65
78 0.68
79 0.65
80 0.61
81 0.57
82 0.55
83 0.52
84 0.48
85 0.43
86 0.36
87 0.28
88 0.23
89 0.18
90 0.12
91 0.09
92 0.08
93 0.08
94 0.11
95 0.11
96 0.1
97 0.11
98 0.1
99 0.12
100 0.12
101 0.13
102 0.1
103 0.1
104 0.11
105 0.11
106 0.12
107 0.1
108 0.09
109 0.07
110 0.06
111 0.06
112 0.05
113 0.05
114 0.04
115 0.03
116 0.04
117 0.04
118 0.05
119 0.06
120 0.06
121 0.06
122 0.07
123 0.07
124 0.11
125 0.18
126 0.19
127 0.19
128 0.21
129 0.22
130 0.22
131 0.23
132 0.27
133 0.25
134 0.33
135 0.4