Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9U8W5

Protein Details
Accession A0A0C9U8W5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-76AEFKKFLTKSQRRFHPDKWRARKBasic
NLS Segment(s)
PositionSequence
66-76RFHPDKWRARK
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 2
Family & Domain DBs
Amino Acid Sequences LSEAFDEAVFNSGKPLSFGSIPWPILERAYSIQDIEWEAVERFFIAVRRFMPSAEFKKFLTKSQRRFHPDKWRARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.13
5 0.13
6 0.16
7 0.2
8 0.21
9 0.2
10 0.2
11 0.18
12 0.18
13 0.18
14 0.15
15 0.12
16 0.14
17 0.14
18 0.12
19 0.12
20 0.12
21 0.12
22 0.1
23 0.09
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.05
30 0.05
31 0.08
32 0.08
33 0.11
34 0.12
35 0.16
36 0.16
37 0.16
38 0.19
39 0.24
40 0.29
41 0.31
42 0.32
43 0.29
44 0.39
45 0.4
46 0.44
47 0.47
48 0.51
49 0.56
50 0.64
51 0.73
52 0.72
53 0.78
54 0.8
55 0.81
56 0.81