Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9E8F0

Protein Details
Accession E9E8F0    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-79MMTCACTARRRRRRGVQPMYGTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 8, plas 4, nucl 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
KEGG maw:MAC_06148  -  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MAPTSTSDASTGASVMGLIKRYYYCDSYGYTYRCNSGWYNWGRWVVLAGVIVIVLLIMMTCACTARRRRRRGVQPMYGTGWMAPASKYDPNHQHQMNNYNQGYQPDYNQGYGQPQGYYNTPPPYGGQPQAPQNTGTTFSPNDGYYGHQQYGVQQPSNTYHPDGGYAPPAGPPPGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.11
5 0.1
6 0.12
7 0.13
8 0.17
9 0.21
10 0.21
11 0.21
12 0.22
13 0.24
14 0.28
15 0.34
16 0.33
17 0.32
18 0.31
19 0.32
20 0.3
21 0.3
22 0.27
23 0.23
24 0.29
25 0.3
26 0.32
27 0.35
28 0.36
29 0.33
30 0.31
31 0.28
32 0.2
33 0.17
34 0.13
35 0.08
36 0.06
37 0.06
38 0.06
39 0.04
40 0.03
41 0.02
42 0.02
43 0.01
44 0.01
45 0.02
46 0.02
47 0.02
48 0.03
49 0.04
50 0.11
51 0.2
52 0.31
53 0.42
54 0.49
55 0.58
56 0.68
57 0.77
58 0.83
59 0.83
60 0.8
61 0.74
62 0.7
63 0.64
64 0.54
65 0.43
66 0.32
67 0.23
68 0.15
69 0.11
70 0.08
71 0.06
72 0.09
73 0.11
74 0.12
75 0.17
76 0.23
77 0.26
78 0.32
79 0.32
80 0.32
81 0.33
82 0.39
83 0.37
84 0.38
85 0.35
86 0.3
87 0.3
88 0.29
89 0.3
90 0.23
91 0.21
92 0.19
93 0.2
94 0.19
95 0.19
96 0.18
97 0.16
98 0.17
99 0.17
100 0.12
101 0.12
102 0.13
103 0.14
104 0.17
105 0.19
106 0.21
107 0.2
108 0.2
109 0.21
110 0.24
111 0.26
112 0.25
113 0.25
114 0.25
115 0.32
116 0.35
117 0.35
118 0.31
119 0.28
120 0.27
121 0.26
122 0.24
123 0.2
124 0.17
125 0.17
126 0.19
127 0.18
128 0.17
129 0.15
130 0.18
131 0.21
132 0.25
133 0.24
134 0.23
135 0.23
136 0.26
137 0.35
138 0.36
139 0.31
140 0.27
141 0.3
142 0.32
143 0.36
144 0.35
145 0.28
146 0.25
147 0.24
148 0.26
149 0.25
150 0.23
151 0.23
152 0.21
153 0.19
154 0.18
155 0.2