Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BGN4

Protein Details
Accession Q6BGN4   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-91KKNMIDCPKIKRRTKSPKSNWKQFTVSHydrophilic
NLS Segment(s)
PositionSequence
75-79KRRTK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 5
Family & Domain DBs
KEGG dha:DEHA2G25036g  -  
Amino Acid Sequences MSQTYSCEKLAYEKLSNNFLFNSVYIDRKFAFGTFNIGKHYHALGPFLIQKYIDQGKENIRSKEKKNMIDCPKIKRRTKSPKSNWKQFTVSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.43
4 0.38
5 0.32
6 0.28
7 0.24
8 0.19
9 0.21
10 0.16
11 0.19
12 0.18
13 0.2
14 0.19
15 0.19
16 0.19
17 0.15
18 0.15
19 0.11
20 0.18
21 0.18
22 0.18
23 0.2
24 0.2
25 0.2
26 0.2
27 0.21
28 0.15
29 0.14
30 0.14
31 0.11
32 0.12
33 0.14
34 0.13
35 0.12
36 0.1
37 0.1
38 0.14
39 0.17
40 0.17
41 0.15
42 0.17
43 0.23
44 0.33
45 0.37
46 0.37
47 0.41
48 0.46
49 0.49
50 0.57
51 0.58
52 0.56
53 0.57
54 0.62
55 0.63
56 0.68
57 0.69
58 0.68
59 0.71
60 0.73
61 0.76
62 0.74
63 0.77
64 0.78
65 0.85
66 0.86
67 0.87
68 0.89
69 0.92
70 0.93
71 0.89
72 0.84