Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E1H5

Protein Details
Accession E9E1H5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
93-113DSCAMCGKPNKKKKADAAPTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019367  PDZ-binding_CRIPT  
Gene Ontology GO:0005737  C:cytoplasm  
KEGG maw:MAC_03723  -  
Pfam View protein in Pfam  
PF10235  Cript  
Amino Acid Sequences MVCTKCQKLSKTTLATPDVKKKSEMYYGSPAASSSKPSGSKSTTLGQSGVVKSKLLSKSAKNPYAQYSSSCTKCKAKVSQGHSLCQTCAYKNDSCAMCGKPNKKKKADAAPTVTGQKFTLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.59
4 0.6
5 0.57
6 0.52
7 0.5
8 0.46
9 0.45
10 0.46
11 0.43
12 0.38
13 0.4
14 0.41
15 0.39
16 0.36
17 0.32
18 0.27
19 0.24
20 0.21
21 0.16
22 0.19
23 0.21
24 0.23
25 0.27
26 0.26
27 0.28
28 0.28
29 0.31
30 0.28
31 0.27
32 0.25
33 0.22
34 0.23
35 0.22
36 0.22
37 0.18
38 0.15
39 0.15
40 0.21
41 0.21
42 0.2
43 0.22
44 0.22
45 0.31
46 0.39
47 0.43
48 0.38
49 0.38
50 0.38
51 0.4
52 0.38
53 0.3
54 0.27
55 0.28
56 0.31
57 0.31
58 0.3
59 0.3
60 0.34
61 0.39
62 0.4
63 0.44
64 0.48
65 0.52
66 0.59
67 0.57
68 0.56
69 0.53
70 0.48
71 0.39
72 0.36
73 0.32
74 0.23
75 0.24
76 0.26
77 0.23
78 0.24
79 0.31
80 0.26
81 0.26
82 0.29
83 0.29
84 0.32
85 0.38
86 0.46
87 0.49
88 0.59
89 0.67
90 0.7
91 0.75
92 0.77
93 0.8
94 0.81
95 0.8
96 0.77
97 0.72
98 0.7
99 0.69
100 0.6
101 0.5