Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9U316

Protein Details
Accession A0A0C9U316   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSSPPFRTMKLRSKKPTCPACGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 8, cyto 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001763  Rhodanese-like_dom  
IPR036873  Rhodanese-like_dom_sf  
Pfam View protein in Pfam  
PF00581  Rhodanese  
PROSITE View protein in PROSITE  
PS50206  RHODANESE_3  
Amino Acid Sequences MSSPPFRTMKLRSKKPTCPACGLKGQKVGQIEDIDYVAFCGGNAPDYEATGLKEGRSGHRIKPKDMQQILQKENVRIIDVRPPIEYDTPLPELVANPSSYLSDSSSQTFVVCRLGNDSQIAADALRSVASENQKIQDLIGGLRAWSRDVDPEFPVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.85
4 0.81
5 0.79
6 0.75
7 0.7
8 0.71
9 0.68
10 0.64
11 0.62
12 0.57
13 0.52
14 0.48
15 0.44
16 0.38
17 0.33
18 0.28
19 0.2
20 0.19
21 0.16
22 0.13
23 0.11
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.09
32 0.09
33 0.09
34 0.1
35 0.1
36 0.1
37 0.11
38 0.12
39 0.09
40 0.12
41 0.13
42 0.15
43 0.2
44 0.22
45 0.26
46 0.35
47 0.38
48 0.38
49 0.45
50 0.49
51 0.54
52 0.52
53 0.5
54 0.48
55 0.54
56 0.52
57 0.51
58 0.45
59 0.35
60 0.35
61 0.32
62 0.25
63 0.18
64 0.17
65 0.18
66 0.18
67 0.18
68 0.16
69 0.17
70 0.18
71 0.18
72 0.18
73 0.12
74 0.14
75 0.15
76 0.15
77 0.14
78 0.12
79 0.12
80 0.13
81 0.13
82 0.09
83 0.08
84 0.09
85 0.09
86 0.09
87 0.1
88 0.1
89 0.11
90 0.12
91 0.14
92 0.14
93 0.14
94 0.13
95 0.13
96 0.12
97 0.13
98 0.12
99 0.11
100 0.15
101 0.16
102 0.17
103 0.18
104 0.17
105 0.13
106 0.13
107 0.13
108 0.08
109 0.07
110 0.06
111 0.06
112 0.05
113 0.06
114 0.06
115 0.11
116 0.15
117 0.19
118 0.21
119 0.23
120 0.25
121 0.25
122 0.24
123 0.22
124 0.18
125 0.15
126 0.17
127 0.15
128 0.13
129 0.15
130 0.16
131 0.14
132 0.14
133 0.15
134 0.18
135 0.21
136 0.24