Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VWN4

Protein Details
Accession A0A0C9VWN4   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-39HLPAKKPKSPYVNKDKKPGTNHPKNKCMNHydrophilic
NLS Segment(s)
PositionSequence
58-69KPGRKRKKVANK
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MNLGDEFDVDHLPAKKPKSPYVNKDKKPGTNHPKNKCMNAGNLVAEAAGNREVTQVEKPGRKRKKVANKSRDEVGRVNDDPVETNNIPKLSQWQKYNDNVQPIADNLQVVHIWQKGNHDNAVITRALYWSWNLHNEVSSALHHLGAKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.38
4 0.46
5 0.52
6 0.59
7 0.65
8 0.71
9 0.77
10 0.77
11 0.81
12 0.8
13 0.77
14 0.75
15 0.76
16 0.76
17 0.76
18 0.81
19 0.79
20 0.82
21 0.78
22 0.74
23 0.7
24 0.63
25 0.56
26 0.51
27 0.45
28 0.36
29 0.32
30 0.28
31 0.2
32 0.17
33 0.12
34 0.09
35 0.07
36 0.06
37 0.06
38 0.06
39 0.07
40 0.09
41 0.1
42 0.14
43 0.18
44 0.23
45 0.3
46 0.4
47 0.48
48 0.52
49 0.57
50 0.62
51 0.69
52 0.74
53 0.79
54 0.79
55 0.78
56 0.75
57 0.74
58 0.66
59 0.58
60 0.49
61 0.4
62 0.35
63 0.28
64 0.26
65 0.2
66 0.19
67 0.16
68 0.15
69 0.18
70 0.13
71 0.14
72 0.16
73 0.16
74 0.15
75 0.15
76 0.22
77 0.22
78 0.28
79 0.3
80 0.34
81 0.39
82 0.43
83 0.51
84 0.46
85 0.44
86 0.39
87 0.36
88 0.31
89 0.26
90 0.25
91 0.18
92 0.14
93 0.1
94 0.11
95 0.1
96 0.09
97 0.12
98 0.12
99 0.12
100 0.13
101 0.2
102 0.23
103 0.26
104 0.27
105 0.24
106 0.23
107 0.24
108 0.25
109 0.19
110 0.14
111 0.12
112 0.12
113 0.11
114 0.11
115 0.12
116 0.13
117 0.17
118 0.21
119 0.23
120 0.23
121 0.24
122 0.23
123 0.23
124 0.21
125 0.18
126 0.18
127 0.16
128 0.17
129 0.17