Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9W2C0

Protein Details
Accession A0A0C9W2C0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
12-38NQPDRMNVRRTRKPRRTQEAQYKQQHNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
Amino Acid Sequences MVSSDESPIGINQPDRMNVRRTRKPRRTQEAQYKQQHNNPTRTIHKPSQPDSNRISQIPNQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.28
4 0.32
5 0.38
6 0.46
7 0.52
8 0.59
9 0.66
10 0.73
11 0.8
12 0.84
13 0.85
14 0.84
15 0.84
16 0.86
17 0.85
18 0.84
19 0.82
20 0.78
21 0.73
22 0.7
23 0.69
24 0.63
25 0.59
26 0.53
27 0.5
28 0.49
29 0.52
30 0.54
31 0.51
32 0.53
33 0.54
34 0.54
35 0.59
36 0.58
37 0.58
38 0.55
39 0.57
40 0.54
41 0.49
42 0.5
43 0.44