Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TV88

Protein Details
Accession A0A0C9TV88   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
64-96KVKSQTPKVDKQEKKKTPKGRANKRLLYNRRFVHydrophilic
NLS Segment(s)
PositionSequence
66-88KSQTPKVDKQEKKKTPKGRANKR
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 12.333, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MIAPKPYWYIGKQLEEFSNSVSSSSSHHTTVLSDLDRVASSSLRQIQYGKRSVCFHGSLARAGKVKSQTPKVDKQEKKKTPKGRANKRLLYNRRFVNVTTLQAGGKRRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.38
4 0.32
5 0.28
6 0.21
7 0.19
8 0.16
9 0.14
10 0.14
11 0.18
12 0.18
13 0.16
14 0.17
15 0.17
16 0.17
17 0.18
18 0.19
19 0.15
20 0.13
21 0.12
22 0.13
23 0.12
24 0.12
25 0.11
26 0.08
27 0.07
28 0.11
29 0.16
30 0.16
31 0.17
32 0.19
33 0.23
34 0.29
35 0.35
36 0.32
37 0.3
38 0.31
39 0.32
40 0.33
41 0.29
42 0.23
43 0.22
44 0.22
45 0.21
46 0.21
47 0.22
48 0.2
49 0.19
50 0.22
51 0.2
52 0.24
53 0.27
54 0.33
55 0.38
56 0.43
57 0.51
58 0.56
59 0.64
60 0.66
61 0.7
62 0.75
63 0.77
64 0.81
65 0.81
66 0.83
67 0.83
68 0.86
69 0.86
70 0.87
71 0.88
72 0.88
73 0.87
74 0.87
75 0.87
76 0.86
77 0.82
78 0.78
79 0.72
80 0.67
81 0.6
82 0.51
83 0.49
84 0.43
85 0.4
86 0.35
87 0.31
88 0.28
89 0.3