Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VY33

Protein Details
Accession A0A0C9VY33    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKTKEKKTKQQKAKEAASHHHydrophilic
190-215THGKTKAPTSKNHRNRILRRSHADSAHydrophilic
NLS Segment(s)
PositionSequence
6-15EKKTKQQKAK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MAKTKEKKTKQQKAKEAASHHAKAKSQTDRSSRDALANRNVNQTQISDEQPQSQSSTDPSTGDIEQPEDNQAVIAAMKAELEQLRAQVQSQGKQAKRKIPKPEGECGRDYSLKEEMELDDDEEKYKAIRHTVRDLVHHSGMQRGVTYIKQDKEKVLGVILQARKDEPYLDEFEGDWAIIDIIKGVLHNFTHGKTKAPTSKNHRNRILRRSHADSANSDSRLDTDSATGQPDDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.86
3 0.8
4 0.78
5 0.76
6 0.7
7 0.66
8 0.61
9 0.55
10 0.53
11 0.56
12 0.56
13 0.54
14 0.58
15 0.6
16 0.61
17 0.63
18 0.63
19 0.56
20 0.54
21 0.53
22 0.5
23 0.51
24 0.52
25 0.49
26 0.51
27 0.5
28 0.44
29 0.39
30 0.34
31 0.29
32 0.25
33 0.26
34 0.24
35 0.25
36 0.28
37 0.29
38 0.29
39 0.26
40 0.24
41 0.21
42 0.19
43 0.22
44 0.18
45 0.17
46 0.17
47 0.18
48 0.18
49 0.19
50 0.17
51 0.15
52 0.15
53 0.15
54 0.15
55 0.12
56 0.12
57 0.1
58 0.09
59 0.07
60 0.06
61 0.06
62 0.04
63 0.04
64 0.04
65 0.04
66 0.06
67 0.06
68 0.08
69 0.08
70 0.09
71 0.1
72 0.1
73 0.11
74 0.15
75 0.17
76 0.18
77 0.23
78 0.3
79 0.32
80 0.39
81 0.44
82 0.47
83 0.54
84 0.58
85 0.63
86 0.63
87 0.68
88 0.65
89 0.7
90 0.68
91 0.62
92 0.57
93 0.5
94 0.44
95 0.39
96 0.34
97 0.28
98 0.25
99 0.21
100 0.19
101 0.17
102 0.14
103 0.14
104 0.14
105 0.12
106 0.09
107 0.09
108 0.1
109 0.09
110 0.09
111 0.07
112 0.09
113 0.09
114 0.14
115 0.18
116 0.21
117 0.26
118 0.32
119 0.33
120 0.34
121 0.36
122 0.35
123 0.32
124 0.29
125 0.24
126 0.22
127 0.21
128 0.18
129 0.14
130 0.11
131 0.11
132 0.11
133 0.16
134 0.19
135 0.21
136 0.25
137 0.26
138 0.27
139 0.29
140 0.3
141 0.25
142 0.21
143 0.19
144 0.15
145 0.21
146 0.22
147 0.2
148 0.19
149 0.19
150 0.19
151 0.18
152 0.18
153 0.13
154 0.15
155 0.17
156 0.18
157 0.18
158 0.17
159 0.18
160 0.17
161 0.15
162 0.11
163 0.06
164 0.06
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.07
173 0.07
174 0.11
175 0.12
176 0.14
177 0.22
178 0.22
179 0.26
180 0.27
181 0.35
182 0.41
183 0.44
184 0.52
185 0.53
186 0.64
187 0.7
188 0.77
189 0.79
190 0.8
191 0.85
192 0.86
193 0.87
194 0.85
195 0.82
196 0.8
197 0.78
198 0.73
199 0.67
200 0.6
201 0.58
202 0.56
203 0.49
204 0.41
205 0.34
206 0.3
207 0.29
208 0.27
209 0.19
210 0.15
211 0.17
212 0.18
213 0.2