Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9EGD6

Protein Details
Accession E9EGD6   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-39GGALKLKGAKVQKKKKKKGKTDLERNLSAHydrophilic
NLS Segment(s)
PositionSequence
15-30KLKGAKVQKKKKKKGK
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG maw:MAC_08934  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSGDYTAVGGGALKLKGAKVQKKKKKKGKTDLERNLSAGDGALAKSDDAPAADKQPDHRDSKDHQRDDDGAVARKTESERKYDEVRKKRLQKMAESSSSRPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.16
5 0.25
6 0.33
7 0.41
8 0.52
9 0.62
10 0.73
11 0.84
12 0.89
13 0.91
14 0.93
15 0.93
16 0.93
17 0.94
18 0.94
19 0.93
20 0.89
21 0.8
22 0.7
23 0.59
24 0.48
25 0.36
26 0.24
27 0.15
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.08
38 0.08
39 0.11
40 0.12
41 0.12
42 0.15
43 0.22
44 0.26
45 0.28
46 0.28
47 0.29
48 0.33
49 0.44
50 0.5
51 0.44
52 0.41
53 0.39
54 0.4
55 0.37
56 0.37
57 0.28
58 0.22
59 0.2
60 0.19
61 0.17
62 0.17
63 0.18
64 0.2
65 0.2
66 0.21
67 0.24
68 0.28
69 0.35
70 0.43
71 0.5
72 0.52
73 0.6
74 0.65
75 0.72
76 0.76
77 0.75
78 0.71
79 0.7
80 0.69
81 0.67
82 0.66
83 0.61
84 0.55
85 0.54
86 0.51
87 0.43
88 0.35
89 0.29
90 0.28
91 0.31
92 0.4
93 0.4
94 0.47
95 0.5
96 0.52
97 0.53
98 0.54
99 0.54
100 0.46
101 0.42
102 0.41
103 0.38
104 0.37
105 0.35
106 0.28
107 0.21
108 0.19
109 0.2
110 0.19
111 0.21
112 0.27
113 0.33
114 0.34