Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9U2K9

Protein Details
Accession A0A0C9U2K9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-51KECNSECKSHRNKRRYRPASPTRFNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
Amino Acid Sequences MGAFPSPTSKFDTSRNGAQASREVQKECNSECKSHRNKRRYRPASPTRFNVASIGICASSVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.42
4 0.4
5 0.39
6 0.37
7 0.32
8 0.32
9 0.28
10 0.26
11 0.26
12 0.3
13 0.31
14 0.28
15 0.34
16 0.31
17 0.32
18 0.35
19 0.42
20 0.48
21 0.54
22 0.63
23 0.63
24 0.71
25 0.78
26 0.87
27 0.84
28 0.82
29 0.83
30 0.84
31 0.85
32 0.82
33 0.76
34 0.72
35 0.65
36 0.58
37 0.48
38 0.4
39 0.3
40 0.25
41 0.21
42 0.14