Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VZR9

Protein Details
Accession A0A0C9VZR9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSKKPAGGKRKDPLETBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSKKPAGGKRK
Subcellular Location(s) nucl 12, mito 10.5, cyto_nucl 8.833, cyto_mito 7.666, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSKKPAGGKRKDPLETSFTCLYCHHEKAVTVKLDRKEGIAYLSCKICSQAYQSKVNHLTEPIDIYSEWIDAADEAEKGLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.84
4 0.77
5 0.69
6 0.63
7 0.58
8 0.5
9 0.47
10 0.43
11 0.35
12 0.32
13 0.3
14 0.32
15 0.3
16 0.29
17 0.25
18 0.22
19 0.22
20 0.25
21 0.31
22 0.28
23 0.25
24 0.29
25 0.3
26 0.31
27 0.31
28 0.27
29 0.21
30 0.18
31 0.19
32 0.16
33 0.16
34 0.15
35 0.15
36 0.15
37 0.14
38 0.15
39 0.13
40 0.11
41 0.16
42 0.22
43 0.25
44 0.33
45 0.33
46 0.4
47 0.44
48 0.45
49 0.4
50 0.34
51 0.31
52 0.24
53 0.26
54 0.19
55 0.16
56 0.14
57 0.14
58 0.14
59 0.12
60 0.11
61 0.08
62 0.08
63 0.07
64 0.08
65 0.08
66 0.07