Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W0TYU9

Protein Details
Accession W0TYU9   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-89PPEQNKFKQYERFKKQRNANSNTSNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015898  G-protein_gamma-like_dom  
IPR041848  Ste18_fungal  
Gene Ontology GO:0031681  F:G-protein beta-subunit binding  
GO:0007186  P:G protein-coupled receptor signaling pathway  
GO:0000750  P:pheromone-dependent signal transduction involved in conjugation with cellular fusion  
KEGG dha:DEHA2G24024g  -  
Pfam View protein in Pfam  
PF00631  G-gamma  
Amino Acid Sequences MEDKSEALSNRIAEIKLRRIQEFNSRLKEALLRERIPASNASLLITNYVQDTPDYIIPSLWKLPPEQNKFKQYERFKKQRNANSNTSNCCTIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.35
4 0.38
5 0.38
6 0.37
7 0.4
8 0.46
9 0.48
10 0.48
11 0.48
12 0.46
13 0.44
14 0.43
15 0.43
16 0.36
17 0.37
18 0.35
19 0.3
20 0.3
21 0.32
22 0.32
23 0.3
24 0.27
25 0.2
26 0.16
27 0.15
28 0.14
29 0.12
30 0.12
31 0.12
32 0.11
33 0.08
34 0.07
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.09
41 0.1
42 0.09
43 0.09
44 0.1
45 0.12
46 0.13
47 0.13
48 0.12
49 0.13
50 0.21
51 0.3
52 0.38
53 0.46
54 0.52
55 0.58
56 0.62
57 0.66
58 0.68
59 0.69
60 0.72
61 0.72
62 0.75
63 0.76
64 0.82
65 0.86
66 0.86
67 0.86
68 0.82
69 0.81
70 0.81
71 0.79
72 0.76
73 0.71