Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UVN8

Protein Details
Accession A0A0C9UVN8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MPPDRTSAEPKRKPRIWKPPVNRKPRAKREEKPKTSAKBasic
NLS Segment(s)
PositionSequence
10-39PKRKPRIWKPPVNRKPRAKREEKPKTSAKV
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPPDRTSAEPKRKPRIWKPPVNRKPRAKREEKPKTSAKVAIKERHENLTTYDWLQVFVFMDKNPGMSQIKVVDHFSSRPKGALVFTQAMLLRHLAARKTLEERVGNEPGALSSKRCCIVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.83
4 0.85
5 0.87
6 0.88
7 0.91
8 0.91
9 0.9
10 0.9
11 0.9
12 0.91
13 0.9
14 0.88
15 0.87
16 0.88
17 0.9
18 0.85
19 0.81
20 0.78
21 0.73
22 0.67
23 0.66
24 0.6
25 0.58
26 0.59
27 0.59
28 0.56
29 0.58
30 0.56
31 0.54
32 0.49
33 0.41
34 0.36
35 0.33
36 0.28
37 0.22
38 0.23
39 0.17
40 0.17
41 0.16
42 0.13
43 0.1
44 0.1
45 0.09
46 0.07
47 0.09
48 0.08
49 0.09
50 0.08
51 0.11
52 0.12
53 0.11
54 0.13
55 0.14
56 0.15
57 0.16
58 0.17
59 0.15
60 0.15
61 0.17
62 0.2
63 0.2
64 0.2
65 0.19
66 0.18
67 0.18
68 0.18
69 0.19
70 0.19
71 0.17
72 0.17
73 0.19
74 0.2
75 0.19
76 0.19
77 0.17
78 0.13
79 0.13
80 0.15
81 0.13
82 0.15
83 0.17
84 0.2
85 0.24
86 0.26
87 0.3
88 0.3
89 0.33
90 0.37
91 0.38
92 0.35
93 0.3
94 0.27
95 0.23
96 0.24
97 0.22
98 0.17
99 0.17
100 0.22