Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UY01

Protein Details
Accession A0A0C9UY01   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTGAFQSKSRKQKLPNTTRNVPSKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 12.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF05225  HTH_psq  
Amino Acid Sequences MTGAFQSKSRKQKLPNTTRNVPSKQIKHTNSITTHPNTSTKGGDMSSEDKAAKEAHIQCALEAFHSGTMKSIRKASNTFNVPFATLQGRTKEHHSHSKGHESQQILTEAEEHSLIDWCVKESQKGRAWTCLDLQQHVYQMKAHTLLSPVLKCHNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.81
4 0.82
5 0.82
6 0.82
7 0.76
8 0.73
9 0.71
10 0.68
11 0.68
12 0.7
13 0.65
14 0.63
15 0.64
16 0.63
17 0.56
18 0.53
19 0.51
20 0.44
21 0.44
22 0.39
23 0.38
24 0.33
25 0.32
26 0.3
27 0.24
28 0.22
29 0.19
30 0.18
31 0.17
32 0.18
33 0.17
34 0.17
35 0.16
36 0.15
37 0.16
38 0.16
39 0.13
40 0.17
41 0.19
42 0.21
43 0.24
44 0.23
45 0.22
46 0.23
47 0.23
48 0.16
49 0.14
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.13
56 0.14
57 0.15
58 0.2
59 0.19
60 0.22
61 0.25
62 0.27
63 0.3
64 0.32
65 0.32
66 0.29
67 0.28
68 0.25
69 0.23
70 0.21
71 0.15
72 0.13
73 0.14
74 0.15
75 0.17
76 0.17
77 0.22
78 0.27
79 0.29
80 0.38
81 0.39
82 0.43
83 0.45
84 0.54
85 0.52
86 0.5
87 0.5
88 0.42
89 0.4
90 0.37
91 0.34
92 0.24
93 0.21
94 0.19
95 0.14
96 0.13
97 0.12
98 0.08
99 0.07
100 0.08
101 0.08
102 0.08
103 0.08
104 0.09
105 0.13
106 0.14
107 0.19
108 0.22
109 0.3
110 0.35
111 0.43
112 0.44
113 0.47
114 0.5
115 0.46
116 0.46
117 0.45
118 0.4
119 0.35
120 0.37
121 0.31
122 0.34
123 0.32
124 0.3
125 0.26
126 0.26
127 0.26
128 0.24
129 0.22
130 0.19
131 0.2
132 0.23
133 0.27
134 0.27
135 0.26