Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UUW6

Protein Details
Accession A0A0C9UUW6   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-27NLKFNLPTKKLKKDPGVPKLPAHydrophilic
NLS Segment(s)
PositionSequence
14-30KKLKKDPGVPKLPAVKA
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MSKNKNLKFNLPTKKLKKDPGVPKLPAVKARVRTHPNRPAQQFIPNVPQSDVPMGTESSLASLAAEAATSSKAADLEDLQENESLSIAKRQYIRALHKVIDQSDVVILVLDARDPEGCRTKLVEDEVRRRESDGKRLVFVLNKIGMVHLSGPYSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.8
4 0.79
5 0.79
6 0.81
7 0.81
8 0.81
9 0.73
10 0.72
11 0.71
12 0.66
13 0.61
14 0.55
15 0.52
16 0.52
17 0.55
18 0.58
19 0.58
20 0.61
21 0.66
22 0.71
23 0.73
24 0.72
25 0.71
26 0.67
27 0.62
28 0.62
29 0.55
30 0.49
31 0.48
32 0.41
33 0.39
34 0.34
35 0.32
36 0.26
37 0.25
38 0.21
39 0.14
40 0.13
41 0.12
42 0.11
43 0.1
44 0.09
45 0.07
46 0.07
47 0.06
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.07
64 0.09
65 0.1
66 0.1
67 0.1
68 0.1
69 0.1
70 0.09
71 0.07
72 0.05
73 0.09
74 0.08
75 0.11
76 0.13
77 0.14
78 0.19
79 0.25
80 0.31
81 0.34
82 0.36
83 0.34
84 0.36
85 0.38
86 0.34
87 0.3
88 0.23
89 0.17
90 0.15
91 0.14
92 0.1
93 0.07
94 0.06
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.06
101 0.07
102 0.11
103 0.18
104 0.18
105 0.2
106 0.22
107 0.23
108 0.25
109 0.3
110 0.34
111 0.35
112 0.44
113 0.49
114 0.51
115 0.5
116 0.49
117 0.53
118 0.5
119 0.52
120 0.52
121 0.48
122 0.46
123 0.47
124 0.47
125 0.43
126 0.39
127 0.36
128 0.28
129 0.26
130 0.25
131 0.24
132 0.21
133 0.18
134 0.18
135 0.13
136 0.12