Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9U5L6

Protein Details
Accession A0A0C9U5L6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-40CLEVPKGTVHPKPRKRKNANTSTQAGHydrophilic
NLS Segment(s)
PositionSequence
26-31KPRKRK
Subcellular Location(s) mito_nucl 11.833, nucl 11.5, mito 10, cyto_nucl 9.166, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MRPTTPTRNLPEKTCLEVPKGTVHPKPRKRKNANTSTQAGIRNVGLEPDQVKKVAKKRLKLPYNIDDWQAHTIHAIWSGHDAMVCAVHWMSFFSWGSDSVMTTLVCLPEASIWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.43
4 0.42
5 0.39
6 0.38
7 0.4
8 0.39
9 0.38
10 0.46
11 0.53
12 0.61
13 0.7
14 0.74
15 0.8
16 0.85
17 0.9
18 0.9
19 0.91
20 0.89
21 0.84
22 0.77
23 0.69
24 0.63
25 0.54
26 0.44
27 0.34
28 0.25
29 0.2
30 0.16
31 0.14
32 0.1
33 0.08
34 0.09
35 0.11
36 0.11
37 0.11
38 0.12
39 0.17
40 0.23
41 0.31
42 0.35
43 0.37
44 0.45
45 0.55
46 0.59
47 0.6
48 0.61
49 0.57
50 0.58
51 0.54
52 0.48
53 0.38
54 0.35
55 0.32
56 0.25
57 0.19
58 0.14
59 0.13
60 0.11
61 0.14
62 0.12
63 0.09
64 0.11
65 0.12
66 0.11
67 0.11
68 0.1
69 0.07
70 0.08
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.08
77 0.08
78 0.11
79 0.12
80 0.12
81 0.13
82 0.14
83 0.16
84 0.15
85 0.15
86 0.11
87 0.14
88 0.12
89 0.12
90 0.13
91 0.11
92 0.11
93 0.11
94 0.1