Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UBT9

Protein Details
Accession A0A0C9UBT9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-34GSPPYSPPSEKKERNRLKRRVKFRFTQSDLHydrophilic
NLS Segment(s)
PositionSequence
15-26KKERNRLKRRVK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.666, mito_nucl 10.999, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPYVGSPPYSPPSEKKERNRLKRRVKFRFTQSDLVMAINEKDDTKWELVNVRSTFPYWMVDEYVAVYAVRCANGRRRFCTDEDLKSLCELLCSSLVLNKRNRSPGIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.67
4 0.74
5 0.82
6 0.88
7 0.9
8 0.91
9 0.91
10 0.92
11 0.92
12 0.88
13 0.85
14 0.84
15 0.84
16 0.78
17 0.75
18 0.64
19 0.57
20 0.5
21 0.42
22 0.32
23 0.22
24 0.16
25 0.11
26 0.1
27 0.07
28 0.07
29 0.08
30 0.1
31 0.11
32 0.11
33 0.11
34 0.14
35 0.15
36 0.22
37 0.21
38 0.2
39 0.2
40 0.2
41 0.19
42 0.17
43 0.17
44 0.1
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.06
53 0.05
54 0.06
55 0.07
56 0.08
57 0.08
58 0.1
59 0.19
60 0.28
61 0.33
62 0.37
63 0.43
64 0.46
65 0.48
66 0.54
67 0.51
68 0.48
69 0.49
70 0.46
71 0.4
72 0.36
73 0.35
74 0.26
75 0.21
76 0.16
77 0.12
78 0.11
79 0.11
80 0.11
81 0.14
82 0.19
83 0.25
84 0.32
85 0.37
86 0.42
87 0.49