Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TZN0

Protein Details
Accession A0A0C9TZN0    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTRAERKALKATQKKKAPKADGEHydrophilic
NLS Segment(s)
PositionSequence
8-17ALKATQKKKA
91-105AKIRKDREEAAARRK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019380  Casein_kinase_sb_PP28  
IPR039876  HAP28  
Pfam View protein in Pfam  
PF10252  PP28  
Amino Acid Sequences MTRAERKALKATQKKKAPKADGEEEEEDDSDLVNPNRLSAKAKKLSDLNAPQPISRREREAKEKQEAKERYWKLHLEGKTDEAKSDLARLAKIRKDREEAAARRKAETEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.84
4 0.8
5 0.78
6 0.78
7 0.76
8 0.71
9 0.68
10 0.61
11 0.53
12 0.46
13 0.38
14 0.3
15 0.2
16 0.16
17 0.1
18 0.12
19 0.1
20 0.12
21 0.12
22 0.13
23 0.14
24 0.15
25 0.19
26 0.21
27 0.3
28 0.35
29 0.35
30 0.37
31 0.38
32 0.4
33 0.43
34 0.43
35 0.38
36 0.36
37 0.36
38 0.34
39 0.36
40 0.37
41 0.34
42 0.3
43 0.31
44 0.3
45 0.35
46 0.43
47 0.49
48 0.51
49 0.56
50 0.61
51 0.57
52 0.63
53 0.6
54 0.54
55 0.56
56 0.51
57 0.46
58 0.45
59 0.44
60 0.38
61 0.43
62 0.41
63 0.36
64 0.35
65 0.35
66 0.36
67 0.34
68 0.31
69 0.24
70 0.24
71 0.19
72 0.2
73 0.19
74 0.15
75 0.17
76 0.21
77 0.26
78 0.31
79 0.38
80 0.42
81 0.45
82 0.5
83 0.51
84 0.56
85 0.6
86 0.62
87 0.64
88 0.65
89 0.6
90 0.56