Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VAZ5

Protein Details
Accession A0A0C9VAZ5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKTPWKLSRTRKANQRKRLKLVDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 12, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFQASRVNFGGLLWKTPWKLSRTRKANQRKRLKLVDSVIEAVAESGIKCSSLVKALELPKESEMLPRDKYTVFSAKSVGYRKGIHKVPKWTRITQRMNPRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.2
4 0.23
5 0.24
6 0.28
7 0.33
8 0.29
9 0.38
10 0.45
11 0.54
12 0.57
13 0.64
14 0.7
15 0.76
16 0.83
17 0.83
18 0.85
19 0.83
20 0.83
21 0.83
22 0.76
23 0.72
24 0.65
25 0.58
26 0.49
27 0.41
28 0.33
29 0.25
30 0.21
31 0.14
32 0.11
33 0.07
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.08
42 0.08
43 0.08
44 0.13
45 0.16
46 0.19
47 0.2
48 0.2
49 0.18
50 0.19
51 0.18
52 0.18
53 0.18
54 0.19
55 0.21
56 0.2
57 0.22
58 0.21
59 0.23
60 0.23
61 0.28
62 0.25
63 0.24
64 0.25
65 0.25
66 0.3
67 0.32
68 0.31
69 0.28
70 0.31
71 0.34
72 0.4
73 0.45
74 0.49
75 0.52
76 0.6
77 0.65
78 0.71
79 0.73
80 0.73
81 0.76
82 0.78
83 0.8
84 0.78
85 0.8