Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TTS1

Protein Details
Accession A0A0C9TTS1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-106RGKGAPKKAKTKADSRRLARKRBasic
NLS Segment(s)
PositionSequence
83-106RARGKGAPKKAKTKADSRRLARKR
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MATVAGGRLNMLKQLRCAIFQTAWNPASIRTGAKYLRKRLRGPSMIQYYPTQISFREVNKKFPELGIVDEDEVMRIKDLASMRARGKGAPKKAKTKADSRRLARKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.29
4 0.31
5 0.29
6 0.27
7 0.3
8 0.3
9 0.3
10 0.29
11 0.28
12 0.26
13 0.22
14 0.23
15 0.2
16 0.19
17 0.13
18 0.17
19 0.21
20 0.29
21 0.36
22 0.43
23 0.5
24 0.55
25 0.58
26 0.61
27 0.66
28 0.63
29 0.59
30 0.58
31 0.56
32 0.51
33 0.49
34 0.41
35 0.34
36 0.3
37 0.27
38 0.19
39 0.12
40 0.14
41 0.15
42 0.18
43 0.26
44 0.26
45 0.32
46 0.35
47 0.36
48 0.34
49 0.31
50 0.31
51 0.22
52 0.23
53 0.17
54 0.15
55 0.14
56 0.14
57 0.13
58 0.1
59 0.1
60 0.08
61 0.06
62 0.05
63 0.05
64 0.09
65 0.1
66 0.16
67 0.19
68 0.24
69 0.25
70 0.3
71 0.31
72 0.29
73 0.38
74 0.41
75 0.48
76 0.54
77 0.6
78 0.65
79 0.73
80 0.8
81 0.76
82 0.78
83 0.78
84 0.78
85 0.81
86 0.79