Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VK99

Protein Details
Accession A0A0C9VK99    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-35KVNKDETPKSKSKKKTKSHPIVDSESHydrophilic
NLS Segment(s)
PositionSequence
18-26KSKSKKKTK
42-53KAKRRKAKGKGK
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MDANSEGEDKVNKDETPKSKSKKKTKSHPIVDSESEETEEVKAKRRKAKGKGKAVDPDYSRNTFPVDYAGCPGIPVRKICEGCKVPVNAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.42
4 0.49
5 0.52
6 0.58
7 0.68
8 0.75
9 0.77
10 0.81
11 0.84
12 0.86
13 0.89
14 0.89
15 0.87
16 0.82
17 0.76
18 0.68
19 0.6
20 0.51
21 0.4
22 0.32
23 0.24
24 0.18
25 0.14
26 0.16
27 0.13
28 0.21
29 0.24
30 0.29
31 0.36
32 0.44
33 0.52
34 0.58
35 0.68
36 0.69
37 0.76
38 0.76
39 0.74
40 0.73
41 0.67
42 0.63
43 0.54
44 0.51
45 0.45
46 0.42
47 0.36
48 0.3
49 0.29
50 0.23
51 0.21
52 0.19
53 0.17
54 0.15
55 0.17
56 0.17
57 0.15
58 0.15
59 0.16
60 0.17
61 0.19
62 0.19
63 0.22
64 0.29
65 0.32
66 0.34
67 0.43
68 0.41
69 0.42
70 0.48