Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UQZ7

Protein Details
Accession A0A0C9UQZ7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-76PQQLGLVKKDRRKRKRLPRLHRCHVLVBasic
NLS Segment(s)
PositionSequence
57-68KKDRRKRKRLPR
Subcellular Location(s) mito 12, nucl 7, cyto_nucl 6.5, cyto 4, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MALVCMSTRAVGVPTPPIPAHLGSFTLCLLTFSHYNLAHFRPHPPPITIPQQLGLVKKDRRKRKRLPRLHRCHVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.17
4 0.18
5 0.19
6 0.19
7 0.2
8 0.15
9 0.16
10 0.13
11 0.14
12 0.12
13 0.11
14 0.09
15 0.09
16 0.08
17 0.09
18 0.09
19 0.09
20 0.14
21 0.14
22 0.15
23 0.16
24 0.17
25 0.18
26 0.18
27 0.21
28 0.21
29 0.24
30 0.26
31 0.25
32 0.26
33 0.28
34 0.35
35 0.34
36 0.3
37 0.28
38 0.3
39 0.3
40 0.29
41 0.28
42 0.28
43 0.32
44 0.39
45 0.47
46 0.54
47 0.63
48 0.71
49 0.79
50 0.82
51 0.87
52 0.91
53 0.93
54 0.94
55 0.94
56 0.94