Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UPA7

Protein Details
Accession A0A0C9UPA7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
61-81VYRIRVRRGNRKKPVPKGATFHydrophilic
NLS Segment(s)
PositionSequence
41-80RPSRPDKARRLGYKAKQGYVVYRIRVRRGNRKKPVPKGAT
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024794  Rbsml_L15e_core_dom_sf  
IPR000439  Ribosomal_L15e  
IPR020925  Ribosomal_L15e_CS  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00827  Ribosomal_L15e  
PROSITE View protein in PROSITE  
PS01194  RIBOSOMAL_L15E  
Amino Acid Sequences MGAYKYIGELYKKKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVVYRIRVRRGNRKKPVPKGATFGKPVRQGVNHLKFQRSLRATAEERVGRRCGNLRVLNSYWINQDGVYKYYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.55
4 0.56
5 0.57
6 0.53
7 0.53
8 0.56
9 0.56
10 0.49
11 0.44
12 0.44
13 0.42
14 0.39
15 0.47
16 0.46
17 0.44
18 0.49
19 0.48
20 0.47
21 0.5
22 0.5
23 0.44
24 0.41
25 0.42
26 0.41
27 0.43
28 0.44
29 0.44
30 0.49
31 0.54
32 0.62
33 0.65
34 0.71
35 0.72
36 0.7
37 0.71
38 0.71
39 0.68
40 0.69
41 0.63
42 0.55
43 0.51
44 0.46
45 0.41
46 0.38
47 0.35
48 0.27
49 0.3
50 0.3
51 0.3
52 0.35
53 0.37
54 0.42
55 0.5
56 0.58
57 0.62
58 0.72
59 0.77
60 0.8
61 0.86
62 0.81
63 0.72
64 0.67
65 0.64
66 0.58
67 0.54
68 0.48
69 0.44
70 0.42
71 0.41
72 0.39
73 0.34
74 0.35
75 0.4
76 0.45
77 0.46
78 0.44
79 0.45
80 0.46
81 0.47
82 0.5
83 0.42
84 0.37
85 0.33
86 0.37
87 0.37
88 0.36
89 0.42
90 0.37
91 0.36
92 0.38
93 0.38
94 0.31
95 0.32
96 0.35
97 0.33
98 0.38
99 0.42
100 0.41
101 0.45
102 0.46
103 0.49
104 0.46
105 0.42
106 0.36
107 0.31
108 0.29
109 0.22
110 0.25
111 0.21