Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VPA0

Protein Details
Accession A0A0C9VPA0    Localization Confidence High Confidence Score 23.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-49QSRSPTPERYKERSSHKRHRSRSRDKDRRRSRSVSRDRDRSEDRBasic
192-212AATNKFLKRKREKMEEKERVEBasic
270-294DAARARWDAKKKTDPREQDRNERAEHydrophilic
NLS Segment(s)
PositionSequence
15-41YKERSSHKRHRSRSRDKDRRRSRSVSR
199-210KRKREKMEEKER
216-234GPKPVGKEGLLEKKRAKRE
278-281AKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
Amino Acid Sequences MPQRTQSRSPTPERYKERSSHKRHRSRSRDKDRRRSRSVSRDRDRSEDRSDSRALPPGIEPISEDDYFLKNAEFSRWLRVEKGKYFNELRSDKTRSYFRKFVKAWNRGKLADDLYSPIDPISVPSSQQTSYKWGFASAGKVNQDELRRVRDTIGGDTYGPSRSNQSRGRVLGPTLPSTSDLQLAREESESLAATNKFLKRKREKMEEKERVEDLVGPKPVGKEGLLEKKRAKRESDKTFREAKEDAGLEVSEDVLMGGNSSFKEAIARRDAARARWDAKKKTDPREQDRNERAEQLREKDRKTMEMFKQMAKERFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.77
3 0.77
4 0.79
5 0.79
6 0.8
7 0.81
8 0.84
9 0.87
10 0.89
11 0.92
12 0.93
13 0.93
14 0.94
15 0.95
16 0.95
17 0.95
18 0.96
19 0.96
20 0.95
21 0.92
22 0.89
23 0.88
24 0.88
25 0.88
26 0.88
27 0.86
28 0.86
29 0.81
30 0.81
31 0.77
32 0.72
33 0.68
34 0.66
35 0.6
36 0.54
37 0.53
38 0.49
39 0.45
40 0.46
41 0.39
42 0.32
43 0.29
44 0.3
45 0.27
46 0.24
47 0.21
48 0.18
49 0.23
50 0.21
51 0.21
52 0.18
53 0.19
54 0.19
55 0.19
56 0.15
57 0.11
58 0.12
59 0.14
60 0.17
61 0.16
62 0.24
63 0.26
64 0.28
65 0.31
66 0.37
67 0.42
68 0.44
69 0.51
70 0.45
71 0.48
72 0.5
73 0.49
74 0.51
75 0.46
76 0.44
77 0.43
78 0.46
79 0.42
80 0.44
81 0.49
82 0.47
83 0.53
84 0.56
85 0.52
86 0.58
87 0.57
88 0.62
89 0.64
90 0.67
91 0.66
92 0.66
93 0.66
94 0.57
95 0.58
96 0.51
97 0.43
98 0.34
99 0.28
100 0.22
101 0.2
102 0.19
103 0.16
104 0.13
105 0.1
106 0.08
107 0.09
108 0.1
109 0.08
110 0.09
111 0.1
112 0.12
113 0.12
114 0.14
115 0.14
116 0.17
117 0.18
118 0.2
119 0.18
120 0.17
121 0.18
122 0.17
123 0.21
124 0.17
125 0.19
126 0.18
127 0.19
128 0.19
129 0.21
130 0.22
131 0.21
132 0.21
133 0.23
134 0.23
135 0.24
136 0.24
137 0.24
138 0.23
139 0.21
140 0.2
141 0.15
142 0.14
143 0.14
144 0.14
145 0.12
146 0.11
147 0.09
148 0.13
149 0.14
150 0.21
151 0.25
152 0.29
153 0.32
154 0.33
155 0.35
156 0.32
157 0.31
158 0.28
159 0.25
160 0.23
161 0.19
162 0.17
163 0.16
164 0.17
165 0.16
166 0.16
167 0.15
168 0.14
169 0.14
170 0.15
171 0.14
172 0.13
173 0.13
174 0.09
175 0.1
176 0.09
177 0.08
178 0.1
179 0.09
180 0.09
181 0.14
182 0.18
183 0.24
184 0.28
185 0.38
186 0.45
187 0.55
188 0.62
189 0.68
190 0.74
191 0.78
192 0.85
193 0.84
194 0.79
195 0.74
196 0.66
197 0.55
198 0.46
199 0.39
200 0.31
201 0.27
202 0.24
203 0.2
204 0.21
205 0.21
206 0.21
207 0.18
208 0.15
209 0.12
210 0.18
211 0.29
212 0.3
213 0.34
214 0.4
215 0.47
216 0.55
217 0.56
218 0.57
219 0.56
220 0.64
221 0.71
222 0.74
223 0.73
224 0.69
225 0.74
226 0.68
227 0.62
228 0.53
229 0.44
230 0.4
231 0.34
232 0.29
233 0.22
234 0.21
235 0.16
236 0.15
237 0.13
238 0.07
239 0.06
240 0.05
241 0.04
242 0.04
243 0.04
244 0.04
245 0.06
246 0.06
247 0.08
248 0.08
249 0.07
250 0.13
251 0.15
252 0.21
253 0.25
254 0.28
255 0.28
256 0.36
257 0.39
258 0.37
259 0.42
260 0.42
261 0.41
262 0.48
263 0.56
264 0.56
265 0.62
266 0.68
267 0.7
268 0.74
269 0.79
270 0.8
271 0.8
272 0.84
273 0.82
274 0.82
275 0.82
276 0.79
277 0.72
278 0.7
279 0.64
280 0.63
281 0.62
282 0.59
283 0.61
284 0.62
285 0.61
286 0.61
287 0.61
288 0.59
289 0.59
290 0.62
291 0.59
292 0.62
293 0.62
294 0.59
295 0.64
296 0.65