Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9TQB3

Protein Details
Accession A0A0C9TQB3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
80-102YCESRRRRGGRTPQRRVRGKEYQBasic
NLS Segment(s)
PositionSequence
84-99RRRRGGRTPQRRVRGK
Subcellular Location(s) extr 9, nucl 8, mito 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MDGLLCQLKPLLAALGSQSVAGVTHRKLFGQNSCESVRKKGDGSNRSLASWLGTLQTCLAALGSQSVAGVTHRKLLGQNYCESRRRRGGRTPQRRVRGKEYQPRCGAATPRDLFKRATQLRPIRPPPDASGFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.11
5 0.1
6 0.08
7 0.08
8 0.1
9 0.12
10 0.11
11 0.16
12 0.16
13 0.17
14 0.2
15 0.25
16 0.3
17 0.31
18 0.32
19 0.32
20 0.34
21 0.39
22 0.38
23 0.39
24 0.36
25 0.33
26 0.33
27 0.33
28 0.39
29 0.39
30 0.44
31 0.46
32 0.43
33 0.41
34 0.4
35 0.35
36 0.27
37 0.21
38 0.15
39 0.09
40 0.08
41 0.08
42 0.08
43 0.08
44 0.06
45 0.06
46 0.05
47 0.04
48 0.03
49 0.04
50 0.04
51 0.03
52 0.03
53 0.04
54 0.04
55 0.06
56 0.1
57 0.09
58 0.13
59 0.13
60 0.13
61 0.15
62 0.19
63 0.23
64 0.22
65 0.26
66 0.29
67 0.34
68 0.41
69 0.42
70 0.44
71 0.48
72 0.51
73 0.52
74 0.56
75 0.62
76 0.67
77 0.75
78 0.8
79 0.79
80 0.84
81 0.86
82 0.83
83 0.8
84 0.79
85 0.78
86 0.77
87 0.75
88 0.75
89 0.7
90 0.66
91 0.6
92 0.54
93 0.49
94 0.43
95 0.46
96 0.38
97 0.42
98 0.43
99 0.42
100 0.4
101 0.39
102 0.47
103 0.43
104 0.48
105 0.52
106 0.58
107 0.65
108 0.73
109 0.76
110 0.7
111 0.67
112 0.65
113 0.61