Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VH99

Protein Details
Accession A0A0C9VH99   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-107LAPGIRPCPLKRRCRRCRRLDCERGAGVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000277  Cys/Met-Metab_PyrdxlP-dep_enz  
IPR015422  PyrdxlP-dep_Trfase_small  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030170  F:pyridoxal phosphate binding  
GO:0019346  P:transsulfuration  
Pfam View protein in Pfam  
PF01053  Cys_Met_Meta_PP  
Amino Acid Sequences MGGSLLMRRKKGTSGRAKAISLSVGWYRLGSEGLVDDGATERLLTRTRLFTLAESLVGVESLAELPEKMTHGSIPPAERLAPGIRPCPLKRRCRRCRRLDCERGAGVVVGRQCVEKRQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.66
4 0.65
5 0.58
6 0.51
7 0.42
8 0.31
9 0.26
10 0.19
11 0.15
12 0.15
13 0.13
14 0.13
15 0.12
16 0.12
17 0.09
18 0.07
19 0.07
20 0.07
21 0.07
22 0.06
23 0.05
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.07
30 0.09
31 0.1
32 0.11
33 0.13
34 0.15
35 0.16
36 0.16
37 0.15
38 0.17
39 0.15
40 0.13
41 0.11
42 0.1
43 0.08
44 0.07
45 0.06
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.09
60 0.11
61 0.12
62 0.12
63 0.13
64 0.13
65 0.13
66 0.14
67 0.14
68 0.16
69 0.17
70 0.19
71 0.21
72 0.27
73 0.29
74 0.37
75 0.44
76 0.5
77 0.59
78 0.68
79 0.76
80 0.82
81 0.9
82 0.91
83 0.94
84 0.92
85 0.93
86 0.92
87 0.88
88 0.84
89 0.75
90 0.64
91 0.54
92 0.45
93 0.34
94 0.27
95 0.21
96 0.15
97 0.14
98 0.15
99 0.16