Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9USG0

Protein Details
Accession A0A0C9USG0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-73LEDGQRQRQRQRYRYRYRSRSRTGYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 5, cyto 4.5, cyto_pero 4, pero 2.5, plas 2
Family & Domain DBs
Amino Acid Sequences MYMSMRAKPIIAETTNTSSNWGEWGEWDEWSPWGEWSEWDPWDKWSELEDGQRQRQRQRYRYRYRSRSRTGYDDKNGDTDVDVDVDVDVDVGVDIDIDILD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.29
5 0.23
6 0.22
7 0.21
8 0.17
9 0.13
10 0.11
11 0.16
12 0.14
13 0.13
14 0.14
15 0.13
16 0.13
17 0.14
18 0.13
19 0.09
20 0.1
21 0.1
22 0.1
23 0.12
24 0.14
25 0.14
26 0.15
27 0.15
28 0.16
29 0.18
30 0.17
31 0.15
32 0.13
33 0.14
34 0.14
35 0.18
36 0.22
37 0.23
38 0.29
39 0.33
40 0.34
41 0.38
42 0.45
43 0.5
44 0.54
45 0.62
46 0.66
47 0.74
48 0.82
49 0.87
50 0.88
51 0.89
52 0.9
53 0.86
54 0.84
55 0.78
56 0.76
57 0.73
58 0.71
59 0.67
60 0.62
61 0.55
62 0.48
63 0.44
64 0.35
65 0.28
66 0.2
67 0.14
68 0.11
69 0.09
70 0.08
71 0.07
72 0.07
73 0.06
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03