Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W359

Protein Details
Accession A0A0C9W359   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-90ENLKVQCKERRERAKKRGQNRGNMIHydrophilic
NLS Segment(s)
PositionSequence
75-82RRERAKKR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MDHNHQADGSIIYVQAFNTETAEQLNAWFGGYEAQLNKMTDYNHDFFVHCILFLYQEEWRYRRTQENLKVQCKERRERAKKRGQNRGNMIIDEVSSECSSLSEAEASYYGSEDDISENEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.1
6 0.1
7 0.1
8 0.11
9 0.12
10 0.1
11 0.09
12 0.1
13 0.08
14 0.08
15 0.07
16 0.06
17 0.07
18 0.07
19 0.09
20 0.08
21 0.11
22 0.14
23 0.14
24 0.15
25 0.16
26 0.16
27 0.17
28 0.22
29 0.21
30 0.21
31 0.22
32 0.21
33 0.19
34 0.22
35 0.18
36 0.12
37 0.11
38 0.09
39 0.09
40 0.09
41 0.1
42 0.08
43 0.12
44 0.14
45 0.15
46 0.17
47 0.18
48 0.2
49 0.24
50 0.28
51 0.34
52 0.4
53 0.5
54 0.57
55 0.61
56 0.63
57 0.61
58 0.62
59 0.6
60 0.58
61 0.57
62 0.6
63 0.65
64 0.71
65 0.77
66 0.82
67 0.83
68 0.86
69 0.87
70 0.83
71 0.82
72 0.78
73 0.77
74 0.68
75 0.6
76 0.52
77 0.42
78 0.35
79 0.27
80 0.2
81 0.13
82 0.11
83 0.1
84 0.09
85 0.09
86 0.1
87 0.09
88 0.09
89 0.07
90 0.07
91 0.09
92 0.09
93 0.1
94 0.09
95 0.09
96 0.08
97 0.08
98 0.08
99 0.07
100 0.09