Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VL47

Protein Details
Accession A0A0C9VL47   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
39-64RIILCGRQTRRRPKASRSLRRRFPLHHydrophilic
NLS Segment(s)
PositionSequence
48-60RRRPKASRSLRRR
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MNTTTHSFLRFRVRISSTLHPRCPSHPASPRRPLIPNHRIILCGRQTRRRPKASRSLRRRFPLHVPISPRLAPACLEPSDYTPEFCRGLKMYWKSCSISKPWYGANMKGSFFTPSLTTWSVASTKLKDRETYPCCLCASPSLSSLLRVHDAPLTLLITIPGSGSMGVLITGPGEDGVWRAYEECTLVIPET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.52
4 0.53
5 0.59
6 0.62
7 0.59
8 0.58
9 0.57
10 0.58
11 0.53
12 0.52
13 0.53
14 0.57
15 0.62
16 0.68
17 0.7
18 0.67
19 0.67
20 0.64
21 0.66
22 0.66
23 0.63
24 0.57
25 0.54
26 0.5
27 0.46
28 0.48
29 0.44
30 0.44
31 0.43
32 0.48
33 0.57
34 0.66
35 0.74
36 0.76
37 0.75
38 0.75
39 0.81
40 0.82
41 0.84
42 0.84
43 0.84
44 0.83
45 0.84
46 0.79
47 0.72
48 0.69
49 0.68
50 0.63
51 0.57
52 0.54
53 0.5
54 0.51
55 0.46
56 0.39
57 0.29
58 0.24
59 0.2
60 0.16
61 0.17
62 0.13
63 0.14
64 0.14
65 0.15
66 0.2
67 0.19
68 0.19
69 0.16
70 0.18
71 0.18
72 0.17
73 0.17
74 0.13
75 0.15
76 0.21
77 0.25
78 0.27
79 0.29
80 0.31
81 0.31
82 0.32
83 0.32
84 0.28
85 0.28
86 0.26
87 0.25
88 0.23
89 0.29
90 0.28
91 0.28
92 0.3
93 0.28
94 0.26
95 0.25
96 0.24
97 0.19
98 0.18
99 0.16
100 0.12
101 0.1
102 0.14
103 0.14
104 0.14
105 0.12
106 0.14
107 0.14
108 0.14
109 0.16
110 0.15
111 0.21
112 0.27
113 0.28
114 0.28
115 0.3
116 0.39
117 0.4
118 0.44
119 0.39
120 0.36
121 0.36
122 0.34
123 0.32
124 0.26
125 0.26
126 0.21
127 0.2
128 0.21
129 0.2
130 0.23
131 0.23
132 0.21
133 0.19
134 0.18
135 0.18
136 0.16
137 0.16
138 0.14
139 0.14
140 0.12
141 0.1
142 0.1
143 0.09
144 0.08
145 0.07
146 0.07
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.04
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.07
165 0.08
166 0.09
167 0.09
168 0.1
169 0.11
170 0.11
171 0.11