Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UMA0

Protein Details
Accession A0A0C9UMA0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
131-159VAPATPTKVKSRKQEKKEKQEQKAQEAKKHydrophilic
NLS Segment(s)
PositionSequence
138-166KVKSRKQEKKEKQEQKAQEAKKIEKAKSS
Subcellular Location(s) nucl 13.5, mito_nucl 11.166, cyto_nucl 9.333, mito 7.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MQPSPITDMHLFISFLIASPHLSPAPASAKPTPQTENVLLASDFPALPASSSTEAPKREQNQPYIQPPKPEPKVASQAPTTTKKQSVKSAAKDTKASSTVPEPISKPSESPIKLSIPVPVPVFVPVPTPSVAPATPTKVKSRKQEKKEKQEQKAQEAKKIEKAKSSKNLYSQKYRGNLNRSSQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.1
5 0.1
6 0.1
7 0.13
8 0.11
9 0.12
10 0.12
11 0.15
12 0.19
13 0.19
14 0.23
15 0.24
16 0.3
17 0.33
18 0.37
19 0.36
20 0.33
21 0.37
22 0.34
23 0.35
24 0.29
25 0.28
26 0.24
27 0.21
28 0.19
29 0.15
30 0.13
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.1
37 0.11
38 0.12
39 0.15
40 0.18
41 0.21
42 0.23
43 0.29
44 0.3
45 0.38
46 0.41
47 0.45
48 0.48
49 0.52
50 0.58
51 0.59
52 0.57
53 0.52
54 0.52
55 0.55
56 0.5
57 0.49
58 0.42
59 0.39
60 0.44
61 0.41
62 0.41
63 0.33
64 0.33
65 0.34
66 0.37
67 0.34
68 0.3
69 0.35
70 0.36
71 0.37
72 0.4
73 0.45
74 0.47
75 0.49
76 0.56
77 0.53
78 0.51
79 0.5
80 0.44
81 0.38
82 0.33
83 0.28
84 0.2
85 0.17
86 0.2
87 0.19
88 0.2
89 0.18
90 0.19
91 0.22
92 0.21
93 0.2
94 0.18
95 0.24
96 0.23
97 0.24
98 0.24
99 0.23
100 0.24
101 0.24
102 0.25
103 0.2
104 0.22
105 0.2
106 0.18
107 0.16
108 0.16
109 0.16
110 0.13
111 0.13
112 0.12
113 0.13
114 0.13
115 0.12
116 0.12
117 0.13
118 0.13
119 0.14
120 0.15
121 0.19
122 0.24
123 0.26
124 0.34
125 0.4
126 0.47
127 0.54
128 0.64
129 0.68
130 0.73
131 0.82
132 0.84
133 0.87
134 0.92
135 0.92
136 0.89
137 0.89
138 0.86
139 0.84
140 0.83
141 0.75
142 0.71
143 0.68
144 0.63
145 0.62
146 0.63
147 0.56
148 0.55
149 0.58
150 0.6
151 0.63
152 0.67
153 0.64
154 0.66
155 0.73
156 0.71
157 0.75
158 0.72
159 0.7
160 0.67
161 0.7
162 0.68
163 0.66
164 0.67