FuNGI

A0A0C9V7K9

Protein Details

Accession

A0A0C9V7K9

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
471-493	TTRARSQEVKRLVKKCRETGWKS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 12, cyto 9, pero 5

Family & Domain DBs

InterPro	View protein in InterPro IPR001538 Man6P_isomerase-2_C IPR005835 NTP_transferase_dom IPR029044 Nucleotide-diphossugar_trans
Gene Ontology	GO:0016779 F:nucleotidyltransferase activity GO:0044271 P:cellular nitrogen compound biosynthetic process GO:0005976 P:polysaccharide metabolic process
Pfam	View protein in Pfam PF01050 MannoseP_isomer PF00483 NTP_transferase
CDD	cd02509 GDP-M1P_Guanylyltransferase

Amino Acid Sequences

MDSPRFPNSRPLHPITAPIPDRAKQGGLSVEDMFTQIMSALQKSTIDIADLRQECNELRQANSNLERYIREQAVHNGSKQQQLAGSPTAPPSPVMRPRTPFLGPSGAIYVPSPLGDHSLSAYPFKVRDIPGFWAVVPAGGAGTRLWPLSRETCPKFLLDLTLRGRSLIQATWDRLLPMAGQARMMVVTGEIHSQAVRDQLPDLLPRNLLAEPSPKESGAAIGLAAAVLCRRDPDAIIGSFAADHMISGEDAFLSAVAEAVETARHNHLVTIGIAPSYPAVGFGYIRLGDKLDIPNAPNARVVSQFKEKPDARTAASYLSTGNYRWNGGMFVVKAKFLMELYHKYQPELAEGLEAIAAQWDDEKLREKALAEIWPTLPKIAIDNAVAEPAAQEGMVAVVPATFGWDDVGDFSSLADLLPAEVNQPRILGDSKWVVTEQSAGGIIVPASERLIACLGVDDLVVVDTPDALLITTRARSQEVKRLVKKCRETGWKSVTL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.52
3	0.57
4	0.49
5	0.47
6	0.45
7	0.41
8	0.44
9	0.4
10	0.39
11	0.3
12	0.32
13	0.31
14	0.28
15	0.29
16	0.26
17	0.23
18	0.22
19	0.21
20	0.18
21	0.12
22	0.1
23	0.07
24	0.08
25	0.09
26	0.1
27	0.1
28	0.11
29	0.12
30	0.13
31	0.15
32	0.13
33	0.13
34	0.13
35	0.14
36	0.22
37	0.23
38	0.23
39	0.21
40	0.23
41	0.22
42	0.26
43	0.3
44	0.23
45	0.24
46	0.32
47	0.34
48	0.4
49	0.45
50	0.43
51	0.39
52	0.39
53	0.39
54	0.34
55	0.38
56	0.32
57	0.28
58	0.28
59	0.34
60	0.41
61	0.42
62	0.4
63	0.4
64	0.42
65	0.46
66	0.43
67	0.37
68	0.29
69	0.28
70	0.31
71	0.26
72	0.24
73	0.2
74	0.22
75	0.21
76	0.2
77	0.19
78	0.18
79	0.24
80	0.31
81	0.37
82	0.41
83	0.44
84	0.46
85	0.5
86	0.48
87	0.42
88	0.37
89	0.36
90	0.3
91	0.27
92	0.28
93	0.22
94	0.21
95	0.2
96	0.17
97	0.11
98	0.11
99	0.1
100	0.07
101	0.1
102	0.09
103	0.1
104	0.1
105	0.13
106	0.14
107	0.15
108	0.15
109	0.14
110	0.15
111	0.16
112	0.19
113	0.18
114	0.21
115	0.23
116	0.26
117	0.27
118	0.27
119	0.25
120	0.22
121	0.2
122	0.16
123	0.13
124	0.08
125	0.06
126	0.05
127	0.06
128	0.04
129	0.06
130	0.06
131	0.07
132	0.07
133	0.08
134	0.11
135	0.16
136	0.21
137	0.29
138	0.32
139	0.35
140	0.36
141	0.36
142	0.34
143	0.29
144	0.3
145	0.23
146	0.27
147	0.27
148	0.3
149	0.29
150	0.28
151	0.27
152	0.22
153	0.22
154	0.16
155	0.17
156	0.17
157	0.19
158	0.2
159	0.2
160	0.19
161	0.17
162	0.17
163	0.12
164	0.12
165	0.14
166	0.13
167	0.13
168	0.12
169	0.12
170	0.12
171	0.12
172	0.08
173	0.04
174	0.05
175	0.05
176	0.06
177	0.06
178	0.06
179	0.06
180	0.06
181	0.06
182	0.09
183	0.09
184	0.09
185	0.09
186	0.1
187	0.11
188	0.14
189	0.16
190	0.14
191	0.14
192	0.14
193	0.15
194	0.14
195	0.13
196	0.12
197	0.15
198	0.15
199	0.19
200	0.2
201	0.18
202	0.18
203	0.18
204	0.17
205	0.12
206	0.1
207	0.06
208	0.05
209	0.05
210	0.04
211	0.04
212	0.03
213	0.03
214	0.03
215	0.03
216	0.03
217	0.04
218	0.05
219	0.05
220	0.08
221	0.11
222	0.11
223	0.12
224	0.11
225	0.11
226	0.1
227	0.1
228	0.08
229	0.04
230	0.03
231	0.03
232	0.03
233	0.03
234	0.03
235	0.03
236	0.03
237	0.03
238	0.03
239	0.03
240	0.03
241	0.02
242	0.03
243	0.03
244	0.03
245	0.03
246	0.03
247	0.04
248	0.04
249	0.06
250	0.06
251	0.07
252	0.07
253	0.08
254	0.08
255	0.09
256	0.09
257	0.09
258	0.08
259	0.07
260	0.07
261	0.07
262	0.06
263	0.05
264	0.04
265	0.04
266	0.04
267	0.04
268	0.05
269	0.05
270	0.07
271	0.07
272	0.08
273	0.08
274	0.08
275	0.08
276	0.1
277	0.12
278	0.12
279	0.12
280	0.13
281	0.17
282	0.18
283	0.18
284	0.18
285	0.17
286	0.16
287	0.2
288	0.21
289	0.2
290	0.27
291	0.29
292	0.29
293	0.37
294	0.37
295	0.37
296	0.41
297	0.39
298	0.33
299	0.33
300	0.32
301	0.26
302	0.25
303	0.2
304	0.15
305	0.14
306	0.13
307	0.11
308	0.14
309	0.13
310	0.13
311	0.13
312	0.13
313	0.12
314	0.12
315	0.14
316	0.11
317	0.15
318	0.15
319	0.14
320	0.14
321	0.14
322	0.14
323	0.11
324	0.14
325	0.13
326	0.18
327	0.22
328	0.29
329	0.29
330	0.29
331	0.31
332	0.29
333	0.27
334	0.23
335	0.18
336	0.12
337	0.11
338	0.11
339	0.09
340	0.08
341	0.05
342	0.05
343	0.05
344	0.04
345	0.04
346	0.05
347	0.06
348	0.07
349	0.12
350	0.12
351	0.14
352	0.15
353	0.15
354	0.18
355	0.21
356	0.24
357	0.21
358	0.23
359	0.23
360	0.25
361	0.24
362	0.21
363	0.18
364	0.14
365	0.15
366	0.14
367	0.14
368	0.12
369	0.14
370	0.14
371	0.14
372	0.13
373	0.11
374	0.09
375	0.08
376	0.07
377	0.04
378	0.04
379	0.03
380	0.04
381	0.04
382	0.04
383	0.03
384	0.03
385	0.04
386	0.04
387	0.05
388	0.05
389	0.05
390	0.06
391	0.06
392	0.06
393	0.08
394	0.09
395	0.08
396	0.08
397	0.08
398	0.07
399	0.07
400	0.07
401	0.06
402	0.04
403	0.05
404	0.06
405	0.06
406	0.08
407	0.1
408	0.12
409	0.12
410	0.13
411	0.12
412	0.14
413	0.16
414	0.14
415	0.17
416	0.21
417	0.21
418	0.22
419	0.22
420	0.2
421	0.19
422	0.21
423	0.16
424	0.12
425	0.12
426	0.11
427	0.1
428	0.1
429	0.1
430	0.08
431	0.08
432	0.07
433	0.07
434	0.09
435	0.09
436	0.1
437	0.11
438	0.1
439	0.1
440	0.11
441	0.1
442	0.09
443	0.09
444	0.07
445	0.06
446	0.06
447	0.06
448	0.05
449	0.04
450	0.04
451	0.04
452	0.05
453	0.04
454	0.04
455	0.05
456	0.06
457	0.09
458	0.12
459	0.14
460	0.16
461	0.2
462	0.26
463	0.31
464	0.4
465	0.47
466	0.56
467	0.63
468	0.69
469	0.76
470	0.8
471	0.83
472	0.81
473	0.8
474	0.81
475	0.78
476	0.8

A0A0C9V7K9

3D AlphaFold-predicted Structure Viewer