Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UQ30

Protein Details
Accession A0A0C9UQ30   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-32RDNNTSSNARRKPRNNGPDRTKNRADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 2, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MTSNSQRDNNTSSNARRKPRNNGPDRTKNRADPLRVHQSPLHPLEQRTNHDLSHNSIECYNCGKLGHIKPNCPEPIRACHIEAIHVEDLPTEQVNNTNLYINDPIDDEHPDEDKYCNKDYNNQLDLSEDQRSWGSKPSEFNWSDDNQPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.67
4 0.71
5 0.76
6 0.79
7 0.82
8 0.8
9 0.83
10 0.85
11 0.86
12 0.86
13 0.84
14 0.79
15 0.73
16 0.73
17 0.7
18 0.64
19 0.6
20 0.61
21 0.63
22 0.57
23 0.56
24 0.5
25 0.46
26 0.48
27 0.45
28 0.42
29 0.34
30 0.35
31 0.39
32 0.42
33 0.42
34 0.4
35 0.38
36 0.33
37 0.33
38 0.33
39 0.29
40 0.31
41 0.27
42 0.23
43 0.24
44 0.24
45 0.22
46 0.24
47 0.2
48 0.13
49 0.13
50 0.13
51 0.19
52 0.23
53 0.32
54 0.31
55 0.33
56 0.34
57 0.4
58 0.42
59 0.36
60 0.33
61 0.27
62 0.3
63 0.32
64 0.32
65 0.26
66 0.26
67 0.24
68 0.24
69 0.21
70 0.2
71 0.16
72 0.14
73 0.13
74 0.1
75 0.11
76 0.1
77 0.09
78 0.05
79 0.05
80 0.07
81 0.09
82 0.1
83 0.11
84 0.12
85 0.12
86 0.14
87 0.15
88 0.13
89 0.13
90 0.11
91 0.11
92 0.11
93 0.13
94 0.11
95 0.11
96 0.13
97 0.13
98 0.14
99 0.15
100 0.2
101 0.22
102 0.24
103 0.28
104 0.27
105 0.36
106 0.43
107 0.5
108 0.47
109 0.44
110 0.41
111 0.39
112 0.4
113 0.35
114 0.3
115 0.2
116 0.19
117 0.2
118 0.21
119 0.2
120 0.26
121 0.26
122 0.27
123 0.32
124 0.33
125 0.41
126 0.41
127 0.42
128 0.39
129 0.38