Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UEZ2

Protein Details
Accession A0A0C9UEZ2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
277-321FGIPYSESKYKPKPKPKAKPKPKPETTSKPKPKPKAKPKAKPKLLBasic
NLS Segment(s)
PositionSequence
286-321YKPKPKPKAKPKPKPETTSKPKPKPKAKPKAKPKLL
Subcellular Location(s) mito 15, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MLATPTHKWRMSIARSYGIEYTFCTSPEEFFPGGLITDTPDFSEPYWAEIETSEDISDVKDSTWYSILRALRWIFDGNASEALVDATFRDLLRTIGILNRVREVNLQVLIHFLMTGEWQIAKLDAALMDGLFFILGFAENKIESLAVTINRKSLGRPLAQWVANAIASFRYNCRQFQYLKSVNYEDAVQNGLIMSGTHITFIRMEVNDALLEFVETGIRPKDYEDIEVKVFRLDFPGAENASLTLLENLKKFLRCLSTWKKLLPQDYTDFARINSLFGIPYSESKYKPKPKPKAKPKPKPETTSKPKPKPKAKPKAKPKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.55
4 0.51
5 0.42
6 0.35
7 0.28
8 0.28
9 0.21
10 0.2
11 0.21
12 0.19
13 0.2
14 0.22
15 0.25
16 0.21
17 0.2
18 0.2
19 0.17
20 0.17
21 0.15
22 0.12
23 0.09
24 0.11
25 0.11
26 0.12
27 0.12
28 0.13
29 0.12
30 0.2
31 0.17
32 0.18
33 0.19
34 0.18
35 0.17
36 0.17
37 0.2
38 0.14
39 0.15
40 0.12
41 0.11
42 0.11
43 0.11
44 0.12
45 0.09
46 0.08
47 0.09
48 0.1
49 0.12
50 0.15
51 0.15
52 0.15
53 0.2
54 0.22
55 0.2
56 0.26
57 0.24
58 0.22
59 0.24
60 0.24
61 0.18
62 0.2
63 0.21
64 0.16
65 0.17
66 0.15
67 0.13
68 0.12
69 0.11
70 0.08
71 0.07
72 0.05
73 0.05
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.09
80 0.09
81 0.08
82 0.1
83 0.16
84 0.19
85 0.19
86 0.22
87 0.21
88 0.22
89 0.22
90 0.22
91 0.18
92 0.17
93 0.17
94 0.14
95 0.15
96 0.14
97 0.12
98 0.1
99 0.07
100 0.05
101 0.05
102 0.05
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.02
121 0.02
122 0.03
123 0.03
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.04
131 0.05
132 0.06
133 0.08
134 0.1
135 0.11
136 0.12
137 0.13
138 0.13
139 0.13
140 0.16
141 0.18
142 0.17
143 0.18
144 0.22
145 0.26
146 0.26
147 0.25
148 0.21
149 0.17
150 0.16
151 0.15
152 0.11
153 0.07
154 0.07
155 0.07
156 0.08
157 0.13
158 0.14
159 0.16
160 0.19
161 0.21
162 0.23
163 0.27
164 0.35
165 0.36
166 0.36
167 0.37
168 0.36
169 0.32
170 0.31
171 0.28
172 0.18
173 0.13
174 0.12
175 0.09
176 0.08
177 0.07
178 0.06
179 0.05
180 0.05
181 0.04
182 0.05
183 0.05
184 0.06
185 0.06
186 0.07
187 0.07
188 0.08
189 0.11
190 0.09
191 0.11
192 0.1
193 0.11
194 0.1
195 0.1
196 0.09
197 0.06
198 0.06
199 0.05
200 0.04
201 0.04
202 0.04
203 0.06
204 0.07
205 0.08
206 0.08
207 0.09
208 0.13
209 0.14
210 0.18
211 0.19
212 0.2
213 0.23
214 0.23
215 0.23
216 0.2
217 0.19
218 0.15
219 0.16
220 0.13
221 0.11
222 0.13
223 0.17
224 0.16
225 0.16
226 0.15
227 0.13
228 0.13
229 0.12
230 0.1
231 0.08
232 0.09
233 0.12
234 0.12
235 0.15
236 0.18
237 0.19
238 0.19
239 0.22
240 0.25
241 0.24
242 0.34
243 0.41
244 0.47
245 0.5
246 0.52
247 0.55
248 0.54
249 0.59
250 0.54
251 0.5
252 0.45
253 0.46
254 0.47
255 0.42
256 0.38
257 0.32
258 0.33
259 0.27
260 0.24
261 0.2
262 0.17
263 0.14
264 0.14
265 0.18
266 0.13
267 0.16
268 0.21
269 0.24
270 0.27
271 0.34
272 0.45
273 0.51
274 0.61
275 0.68
276 0.73
277 0.8
278 0.89
279 0.93
280 0.94
281 0.95
282 0.96
283 0.96
284 0.96
285 0.95
286 0.92
287 0.91
288 0.9
289 0.89
290 0.89
291 0.9
292 0.89
293 0.89
294 0.91
295 0.92
296 0.92
297 0.93
298 0.93
299 0.93
300 0.94
301 0.95