Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UTQ9

Protein Details
Accession A0A0C9UTQ9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-48SKSDPKPKTKPKLVRGGRRKKTBasic
NLS Segment(s)
PositionSequence
30-48DPKPKTKPKLVRGGRRKKT
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MAPGNEAKRAKTAETTREDGVVQIAASKSDPKPKTKPKLVRGGRRKKTVEAPAARDVAVENAPPAELRRGRSRRAVTPAEGGLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.43
4 0.42
5 0.4
6 0.31
7 0.26
8 0.18
9 0.12
10 0.1
11 0.09
12 0.09
13 0.09
14 0.12
15 0.13
16 0.22
17 0.25
18 0.29
19 0.39
20 0.48
21 0.57
22 0.64
23 0.71
24 0.69
25 0.77
26 0.79
27 0.8
28 0.81
29 0.83
30 0.8
31 0.79
32 0.74
33 0.66
34 0.66
35 0.63
36 0.61
37 0.55
38 0.53
39 0.49
40 0.48
41 0.44
42 0.36
43 0.29
44 0.22
45 0.18
46 0.12
47 0.08
48 0.07
49 0.08
50 0.08
51 0.09
52 0.15
53 0.17
54 0.21
55 0.32
56 0.37
57 0.42
58 0.51
59 0.55
60 0.55
61 0.61
62 0.62
63 0.54
64 0.55
65 0.51