Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VKJ8

Protein Details
Accession A0A0C9VKJ8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
33-52GITITKRRNRLKRSPDCFNLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, cyto 6.5, nucl 6, cyto_mito 4.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008906  HATC_C_dom  
IPR012337  RNaseH-like_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF05699  Dimer_Tnp_hAT  
Amino Acid Sequences NAHLYPVWALLTLDYLPIMASSVSSERAFSAAGITITKRRNRLKRSPDCFNLGHEGDLTCAHHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.04
7 0.04
8 0.05
9 0.06
10 0.09
11 0.09
12 0.09
13 0.09
14 0.1
15 0.09
16 0.08
17 0.08
18 0.06
19 0.06
20 0.06
21 0.07
22 0.12
23 0.17
24 0.21
25 0.28
26 0.36
27 0.45
28 0.53
29 0.63
30 0.69
31 0.75
32 0.79
33 0.8
34 0.76
35 0.73
36 0.65
37 0.58
38 0.54
39 0.44
40 0.37
41 0.29
42 0.25
43 0.2
44 0.21