Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2LF81

Protein Details
Accession A0A0D2LF81    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
66-87NYNYITFRRQTQKKKAPTSEEGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003545  Telomerase_RT  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0003721  F:telomerase RNA reverse transcriptase activity  
Amino Acid Sequences MLQLAKAKSHLIFSDIDLNTERVVYLNIYQNLLMIAIKMHEYLRNWGVGGKRNISFLRGVIERTINYNYITFRRQTQKKKAPTSEEGSVIMRFIIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.25
4 0.23
5 0.23
6 0.21
7 0.2
8 0.18
9 0.09
10 0.09
11 0.09
12 0.1
13 0.17
14 0.18
15 0.18
16 0.18
17 0.18
18 0.17
19 0.16
20 0.13
21 0.06
22 0.05
23 0.04
24 0.05
25 0.05
26 0.06
27 0.08
28 0.09
29 0.12
30 0.13
31 0.13
32 0.13
33 0.14
34 0.16
35 0.2
36 0.21
37 0.21
38 0.21
39 0.23
40 0.24
41 0.23
42 0.21
43 0.15
44 0.17
45 0.15
46 0.15
47 0.13
48 0.15
49 0.14
50 0.17
51 0.18
52 0.15
53 0.15
54 0.16
55 0.17
56 0.18
57 0.21
58 0.19
59 0.24
60 0.33
61 0.42
62 0.5
63 0.59
64 0.66
65 0.73
66 0.82
67 0.84
68 0.81
69 0.8
70 0.76
71 0.7
72 0.62
73 0.55
74 0.47
75 0.39
76 0.31