Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P7W2

Protein Details
Accession A0A0D2P7W2   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-104AERDERLRKRFWRHIRAWNWYRKQRYEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013078  His_Pase_superF_clade-1  
IPR029033  His_PPase_superfam  
IPR001345  PG/BPGM_mutase_AS  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF00300  His_Phos_1  
PROSITE View protein in PROSITE  
PS00175  PG_MUTASE  
CDD cd07067  HP_PGM_like  
Amino Acid Sequences MPGTAPVARVYLVRHGETQANRDGVIQGQMNTALNARGEAQARMVANALGPVGFTRAYSSDLRRASEVRVSADAKMDAERDERLRKRFWRHIRAWNWYRKQRYESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.31
4 0.32
5 0.34
6 0.31
7 0.28
8 0.27
9 0.26
10 0.24
11 0.19
12 0.2
13 0.18
14 0.13
15 0.13
16 0.13
17 0.13
18 0.12
19 0.12
20 0.09
21 0.08
22 0.08
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.13
29 0.13
30 0.13
31 0.12
32 0.09
33 0.08
34 0.08
35 0.07
36 0.04
37 0.04
38 0.03
39 0.04
40 0.04
41 0.04
42 0.05
43 0.06
44 0.09
45 0.12
46 0.14
47 0.2
48 0.21
49 0.22
50 0.23
51 0.23
52 0.22
53 0.24
54 0.23
55 0.18
56 0.21
57 0.21
58 0.2
59 0.21
60 0.19
61 0.16
62 0.16
63 0.14
64 0.12
65 0.12
66 0.15
67 0.18
68 0.27
69 0.32
70 0.35
71 0.42
72 0.48
73 0.57
74 0.64
75 0.7
76 0.72
77 0.74
78 0.8
79 0.81
80 0.84
81 0.84
82 0.84
83 0.83
84 0.82
85 0.83
86 0.8