Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P0D9

Protein Details
Accession A0A0D2P0D9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-36EATTKPRRKAAEKAEKPKGKPKKDPNAPKRALSBasic
NLS Segment(s)
PositionSequence
8-33KPRRKAAEKAEKPKGKPKKDPNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEATTKPRRKAAEKAEKPKGKPKKDPNAPKRALSAYMFFSQDWRERIKTENPDAGFGEVGKLLGAKWKELDDAEKKPYIDQAARDKERADDEKAAYDNKAKGSPDEDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.79
4 0.81
5 0.81
6 0.8
7 0.8
8 0.8
9 0.77
10 0.77
11 0.78
12 0.79
13 0.83
14 0.89
15 0.89
16 0.9
17 0.84
18 0.76
19 0.69
20 0.6
21 0.53
22 0.43
23 0.36
24 0.28
25 0.27
26 0.25
27 0.21
28 0.2
29 0.2
30 0.22
31 0.21
32 0.21
33 0.2
34 0.2
35 0.24
36 0.3
37 0.34
38 0.34
39 0.37
40 0.33
41 0.34
42 0.33
43 0.29
44 0.22
45 0.16
46 0.12
47 0.07
48 0.06
49 0.05
50 0.04
51 0.04
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.11
58 0.12
59 0.18
60 0.19
61 0.23
62 0.26
63 0.28
64 0.27
65 0.27
66 0.29
67 0.28
68 0.25
69 0.27
70 0.33
71 0.4
72 0.42
73 0.43
74 0.41
75 0.39
76 0.44
77 0.42
78 0.37
79 0.33
80 0.32
81 0.35
82 0.37
83 0.35
84 0.3
85 0.32
86 0.3
87 0.28
88 0.31
89 0.27
90 0.27
91 0.3
92 0.32
93 0.31